Recombinant Mouse Vasoactive intestinal polypeptide receptor 2(Vipr2)

Code CSB-CF025860MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P41588
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence ECRFHLEIQEEETKCAELLSSQTENQRACSGVWDNITCWRPADVGETVTVPCPKVFSNFY SRPGNISKNCTSDGWSETFPDFIDACGYNDPEDESKISFYILVKAIYTLGYSVSLMSLTT GSIIICLFRKLHCTRNYIHLNLFLSFMLRAISVLVKDSVLYSSSGLLRCHDQPASWVGCK LSLVFFQYCIMANFYWLLVEGLYLHTLLVAILPPSRCFLAYLLIGWGIPSVCIGAWTATR LSLEDTGCWDTNDHSIPWWVIRMPILISIVVNFALFISIVRILLQKLTSPDVGGNDQSQY KRLAKSTLLLIPLFGVHYMVFAAFPIGISSTYQILFELCVGSFQGLVVAVLYCFLNSEVQ CELKRRWRGLCLTQAGSRDYRLHSWSMSRNGSESALQIHRGSRTQSFLQSETSVI
Source in vitro E.coli expression system
Gene Names Vipr2
Protein Names Recommended name: Vasoactive intestinal polypeptide receptor 2 Short name= VIP-R-2 Alternative name(s): Pituitary adenylate cyclase-activating polypeptide type III receptor Short name= PACAP type III receptor Short name= PACAP
Expression Region 23-437
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is a receptor for VIP as well as PACAP-38 and -27, the activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Can be coupled to phospholipase C.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Tissue Specificity Expressed at high levels in the MIN6 cells, at moderate levels in pancreatic islets, insulin-secreting cells, lung, brain, stomach, and colon, and at low levels in the heart.
Database Links

KEGG: mmu:22355

STRING: 10090.ENSMUSP00000011315

UniGene: Mm.395245

Pathway cAMP signaling pathway

Related Products

Vipr2 Proteins

Vipr2 Proteins for Mus musculus (Mouse)

Vipr2 ELISA Kit

Vipr2 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.