Recombinant Mouse Vesicle-associated membrane protein 2 (Vamp2)

Code CSB-CF025781MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Vamp2; Syb2; Vesicle-associated membrane protein 2; VAMP-2; Synaptobrevin-2
Species
Mus musculus (Mouse)
Expression Region
2-116
Target Protein Sequence
SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Major SNARE protein of synaptic vesicles which mediates fusion of synaptic vesicles to release neurotransmitters. Essential for fast vesicular exocytosis and activity-dependent neurotransmitter release as well as fast endocytosis that mediates rapid reuse of synaptic vesicles. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Gene References into Functions
  1. These observations provide evidence that the synaptobrevin-2 transmembrane domain catalyzes the membrane fusion process by its structural flexibility, actively setting the pace of fusion pore expansion. PMID: 27343350
  2. Thus, lipid-anchored syb2 provides little or no support for exocytosis, and anchoring syb2 to a membrane by a TMD greatly improves its function PMID: 26663078
  3. Vamp2 mutations impair the ability of Munc18-1 to promote trans-SNARE zippering. These mutations inhibit spontaneous as well as evoked neurotransmitter release, providing evidence for the Vamp2-regulating function of Munc18-1 in synaptic exocytosis. PMID: 26572858
  4. These results provide a novel molecular mechanism for autocrine negative feedback regulation of insulin secretion. PMID: 26585489
  5. Results suggest that side chains in the syb2 transmembrane domain influence the kinetics of exocytosis by perturbing the packing of the surrounding lipids PMID: 26153704
  6. Here we report on transgenic mice expressing a ubiquitinated synaptic vesicle protein (Ub(G76V)-GFP-Syb2) that develop progressive degeneration of motor nerve terminals. PMID: 26290230
  7. VAMP2 is the major v-SNARE involved in GLUT4 trafficking to the surface of 3T3-L1 adipocytes. PMID: 25501368
  8. These results indicate a role for the syb2 TMD in nascent fusion pores, but in a very different structural arrangement from that of the syntaxin transmembrane domains. PMID: 25855187
  9. Clustering was dependent on specific interactions of native alpha-synuclein with both synaptobrevin-2/VAMP2 and anionic lipids PMID: 23638301
  10. Findings indicate an essential role for VAMP2 in GLP-1 exocytosis from the GLUTag L cell in response to a variety of established secretagogues. PMID: 24356748
  11. synaptobrevin2 is expressed in cytotoxic T lymphocytes and exclusively localized on granzyme B-containing lytic granules. PMID: 23385584
  12. Data suggest that tryptophans W89/W90 in juxtamembrane region/transmembrane domain of Syb2 act as fusion clamp in chromaffin cells; in mutant protein, alanines A89/A90 promote spontaneous membrane fusion. PMID: 23178715
  13. The tryptophan moiety in SybII keeps secretory vesicles in the release-ready state and support a model wherein tryptophan-mediated protein-lipid interactions assist in bridging the apposing membranes before fusion. PMID: 23136435
  14. microelectrode array measurements in specific hippocampal subregions of VAMP2(+/-) mice showed significant reductions in potassium-evoked glutamate release PMID: 22183055
  15. VAMP2 and VAMP3 are expressed in JG cells, but only VAMP2 is targeted to renin-containing granules and mediates the stimulatory effect of cAMP on renin exocytosis. PMID: 21708949
  16. Two copies of spH per synaptic vesicles (SV) fully rescued evoked fusion whereas SVs expressing only one spH were unable to rapidly fuse upon stimulation. PMID: 21844343
  17. T3 may promote glucose uptake via enhancing insulin-induced phosphorylation of Akt and subsequent translocations of VAMP2 and glucose transporter GLUT4 in adipocytes. PMID: 21792921
  18. multiple SybII actions determine the exquisite temporal regulation of neuronal signaling. PMID: 20685972
  19. Results suggest a model in which the positively charged VAMP2 and syntaxin juxtamembrane regions facilitate fusion by bridging the negatively charged vesicle and plasma membrane leaflets. PMID: 19812247
  20. essential for two fast synapse-specific membrane trafficking reactions: fast exocytosis for neurotransmitter release and fast endocytosis that mediates rapid reuse of synaptic vesicles PMID: 15475946
  21. may function in catalyzing fusion reactions and stabilizing fusion intermediates but is not absolutely required for synaptic fusion PMID: 11691998

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell membrane.
Protein Families
Synaptobrevin family
Tissue Specificity
Expressed in the outer plexiform layer of the retina (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1