Recombinant Mouse Voltage-dependent calcium channel gamma-2 subunit (Cacng2)

Code CSB-CF004416MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cacng2; Stg; Voltage-dependent calcium channel gamma-2 subunit; Neuronal voltage-gated calcium channel gamma-2 subunit; Stargazin; Transmembrane AMPAR regulatory protein gamma-2; TARP gamma-2
Species
Mus musculus (Mouse)
Expression Region
1-323
Target Protein Sequence
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS SRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH NCIQKDSKDSLHANTANRRTTPV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state.
Gene References into Functions
  1. The results from the current study demonstrate that there is an aberrant tissue expression of GABAAR alpha1 and beta2 subunits in the thalamus of PN7-9 juvenile stargazer mice, but that this early change equilibrates during later developmental stages (PN10-12 and PN13-15). PMID: 29099440
  2. Critically, by altering the two interacting loops of TARP gamma2 and TARP gamma8, the authors could entirely remove all allosteric modulation of GluA2, without affecting formation of AMPA receptor-TARP complexes. PMID: 28871958
  3. Learning to cope with stress modulates anterior cingulate cortex stargazin expression in mice. PMID: 27003116
  4. show that upon release of glutamate, synaptic AMPARs were desensitized by transmitter by >90%. As glutamate levels subsequently fell, recovery of transmission occurred due to the presence of the AMPAR accessory protein stargazin that enhances the AMPAR response to low levels of transmitter. PMID: 28919175
  5. we show that the TARP gamma-2 (stargazin) is present in spinal dorasl horn neurons and is necessary in a form of inflammatory pain-induced plasticity PMID: 28559374
  6. the density of AMPARs correlates with that of TARP gamma-2 across SCC synapses and its high expression is linked to high-density AMPAR expression at perforated type of pyramidal cell synapses PMID: 27076426
  7. in the absence of stargazin, the refinement of the retinogeniculate synapse is specifically disrupted during the experience-dependent phase. Stargazin expression and phosphorylation increased with visual deprivation. PMID: 24882000
  8. The results of this study suggested that gamma-2 association, by increasing charge transfer, allows presynaptic AMPARs to depolarize the bouton membrane sufficiently to modulate both phasic and spontaneous release. PMID: 25762667
  9. Thus, gamma-7 is capable of supporting a component of excitatory transmission in PCs, sufficient to maintain essentially normal motor behavior, in the absence of gamma-2. PMID: 25583485
  10. SR interacts with the synaptic proteins, postsynaptic density protein 95 (PSD-95) and stargazin, forming a ternary complex. PMID: 25164819
  11. Region-specific differences investigated in GABAA receptor (GABAAR) subunit expression occur in the ventral posterior and reticular thalamic nucleus regions in the stargazer mouse model of absence epilepsy. PMID: 24417662
  12. The combined loss of the AMPA receptor auxiliary TARPg-2 subunit and the GluK5 subunit leads to early mouse lethality. PMID: 23719165
  13. TARP gamma-2 was specifically expressed in cortical interneurons. Erbin interacts with TARP gamma-2 and is crucial for its stability. PMID: 23354328
  14. This study suggested that, in stg, a trafficking defect in synaptic AMPARs in RTN cells leads to a compensatory increase in synaptic NMDARs and enhanced thalamic excitability. PMID: 22875939
  15. the loss of gamma-2 in stargazer mouse stellate cells induces changes in synaptic transmission that cannot be compensated for by the remaining TARP gamma-7. PMID: 22581185
  16. Results indicate that hippocampal and cerebellar long-term depression share a common pathway, namely dephosphorylation of stargazin by calcineurin. PMID: 22239345
  17. Ataxic phenotype in stargazers is primarily due to absence of AMPA receptors at cerebellar mossy-fiber-granule cell synapses. PMID: 22055455
  18. Data suggest that stargazin interactions with and within the membrane play significant roles in TARP structure and directly visualize TARP functional mechanisms essential for AMPAR trafficking and clustering. PMID: 21426941
  19. these data suggest that stargazin regulates compartment-specific AMPAR trafficking, as well as activity-dependent plasticity in synaptic AMPAR rectification at cerebellar parallel fiber to stellate cell synapses. PMID: 21411637
  20. Results suggest that TARPs gamma-2 and gamma-7 cooperatively promote synaptic expression of cerebellar AMPA receptors, and the latter also promotes glial expression. PMID: 20529126
  21. Stargazin counteracts the Gbetagamma-induced inhibition of Ca(V)2.2 channel currents, caused either by coexpression of the Gbetagamma dimer or by activation of a G protein-coupled receptor. PMID: 20435886
  22. TARP gamma 2 phosphorylation plays a critical role in regulating AMPA receptor-mediated synaptic transmission via a lipid bilayer interaction. PMID: 20547132
  23. In mouse cerebellar granule cells surface delivery of kainate receptor is independent of stargazin, suggesting that stargazin action is highly selective for AMPA receptors. PMID: 12920207
  24. Microtubule-associated protein light chain 2 interacts with the intracellular C-terminal tail of stargazin. PMID: 15136571
  25. role for stargazin in the normal functions of the vestibular system and indicates that some, but not all, of the abnormal motor syndrome of stargazer mice can be attributed to vestibular dysfunction. PMID: 15283975
  26. Stargazin plays a role in AMPA receptor trafficking through the early compartments of the biosynthetic pathway. PMID: 15689545
  27. the cell adhesion function of stargazin preceded its current role in neurons as a regulator of either voltage-dependent calcium channels or AMPA receptors PMID: 15760900
  28. These experiments identify MAGI-2 as a strong candidate for linking TARP/AMPA receptor complexes to a wide range of other postsynaptic molecules and pathways and advance our knowledge of protein interactions at mammalian CNS synapses. PMID: 16870733
  29. Stargazin mutation impairs cerebellar synaptogenesis, synaptic maturation and synaptic protein distribution PMID: 17070505
  30. appears to contribute to multiple AMPA receptor functions including receptor biogenesis and export from the endoplasmic reticulum PMID: 17329203
  31. Stargazin-PSD-95 interaction plays a key role to trap and transiently stabilize diffusing AMPARs in the postsynaptic density PMID: 17329211
  32. Cacng2 subunit expression alters the voltage dependence of channel activity and reduces N-type calcium channel synthesis via activation of the endoplasmic reticulum unfolded protein response. PMID: 17376992
  33. This study indicates that TARPs, in particular gamma-2, are essential for early development, and that most neurons express multiple members of this functionally redundant protein family. PMID: 18634809
  34. Results show that neuronal AMPA receptors and recombinant AMPA receptors coexpressed with stargazin autoinactivate at high concentrations of glutamate, whereas recombinant AMPA receptors expressed alone do not. PMID: 19146816
  35. Previously uncharacterized roles for the TARP intracellular N terminus, loop, and C terminus in modulating both the trafficking and gating of synaptic AMPARs, are reported. PMID: 19549880
  36. Data show that S-nitrosylation of stargazin increases binding to the AMPAR subunit GluR1, causing increased surface expression of the AMPAR. PMID: 19805317

Show More

Hide All

Involvement in disease
Defects in Cacng2 cause the stargazer (stg) phenotype. Stg mice have spike-wave seizures characteristic of absence epilepsy, with accompanying defects in the cerebellum and inner ear.
Subcellular Location
Membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.
Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Tissue Specificity
Brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1