Recombinant Mouse Zinc transporter ZIP14 (Slc39a14)

Code CSB-CF748446MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Slc39a14
Uniprot No.
Alternative Names
Slc39a14; Fad123; Kiaa0062; Zip14; Metal cation symporter ZIP14; Factor for adipocyte differentiation 123; FAD-123; Solute carrier family 39 member 14; Zrt- and Irt-like protein 14; ZIP-14
Species
Mus musculus (Mouse)
Expression Region
29-489
Target Protein Sequence
SSAGLPPLSATSFLEDLMDRYGKNDSLTLTQLKSLLDHLHVGVGRDNVSQPKEGPRNLST CFSSGDLFAAHNLSERSQIGASEFQEFCPTILQQLDSQACTSENQKSEENEQTEEGKPSA IEVWGYGFLCVTVISLCSLMGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEA FGFNPQDNYVSKSAVVFGGFYLFFFTEKILKMLLKQKNEHHHGHNHFTSETLPSKKDQEE GVTEKLQNGDLDHMIPQHCNSELDGKAPGTDEKVIVNSMSVQDLQASQSACYWLKGVRYS DIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNA GMSIQQALFFNFLSACCCYLGLAFGILAGSHFSANWIFALAGGMFLYIALADMFPEMNEV CQEDEKNDSFLVPFVIQNLGLLTGFSIMLVLTMYSGQIQIG
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Electroneutral transporter of the plasma membrane mediating the cellular uptake of the divalent metal cations zinc, manganese and iron that are important for tissue homeostasis, metabolism, development and immunity. Functions as an energy-dependent symporter, transporting through the membranes an electroneutral complex composed of a divalent metal cation and two bicarbonate anions. Beside these endogenous cellular substrates, can also import cadmium a non-essential metal which is cytotoxic and carcinogenic. Controls the cellular uptake by the intestinal epithelium of systemic zinc, which is in turn required to maintain tight junctions and the intestinal permeability. Modifies the activity of zinc-dependent phosphodiesterases, thereby indirectly regulating G protein-coupled receptor signaling pathways important for gluconeogenesis and chondrocyte differentiation. Regulates insulin receptor signaling, glucose uptake, glycogen synthesis and gluconeogenesis in hepatocytes through the zinc-dependent intracellular catabolism of insulin. Through zinc cellular uptake also plays a role in the adaptation of cells to endoplasmic reticulum stress. Major manganese transporter of the basolateral membrane of intestinal epithelial cells, it plays a central role in manganese systemic homeostasis through intestinal manganese uptake. Also involved in manganese extracellular uptake by cells of the blood-brain barrier. May also play a role in manganese and zinc homeostasis participating in their elimination from the blood through the hepatobiliary excretion. Also functions in the extracellular uptake of free iron. May also function intracellularly and mediate the transport from endosomes to cytosol of iron endocytosed by transferrin. Plays a role in innate immunity by regulating the expression of cytokines by activated macrophages.
Gene References into Functions
  1. This study concludes that SLC39A14 is essential for efficient Mn uptake by the liver and pancreas, and its deficiency results in impaired Mn excretion and accumulation of the metal in other tissues. PMID: 29437953
  2. Data indicate SLC39A14 (ZIP14) as a regulator of bone homeostasis, and that manipulating ZIP14 might be a therapeutic strategy for bone diseases. PMID: 29621230
  3. Zip14 activity is needed for adaptation to endoplasmic reticulum stress in liver. PMID: 28673968
  4. Data suggest that most if not all tissues use ZIP8 and ZIP14A/ZIP14B (alternative splicing products) for Zn(2+) uptake, some tissues under basal conditions and others more so when inflammatory stressors are present (as in endotoxemia); collectively, this might lead to substantial alterations in plasma Zn(2+) levels due to Zn(2+) redistribution not just in liver but across many vital organs. PMID: 24728862
  5. the inflammation-responsive zinc transporter ZIP14 has phenotypic effects that are amplified with aging PMID: 27647172
  6. ZIP14 is essential for manganese elimination via the gastrointestinal tract, and a lack of ZIP14 results in manganese accumulation in critical tissues such as the brain PMID: 28536273
  7. Intravitreal holo-transferrin injection decreased Zip 14 protein levels. These data indicate that Zip8 and Zip14 may take up increasing amounts of non-transferrin bound iron in these two mouse models of retinal iron accumulation. PMID: 28057442
  8. ZIP14-mediated zinc transport contributes to regulation of endosomal insulin receptor activity and glucose homeostasis in hepatocytes. PMID: 27703010
  9. Results suggest that aberrant zinc distribution observed with Zip14 ablation impacts adipose cytokine production and metabolism, ultimately increasing fat deposition when exposed to endotoxin. PMID: 26646099
  10. Slc39a14 deficiency in hemochromatotic mice greatly diminished iron loading of the liver and prevented iron deposition in hepatocytes and pancreatic acinar cells. PMID: 26028554
  11. PrP(C) promotes, and possibly regulates, the uptake of iron through DMT1 and Zip14 via its ferrireductase activity. PMID: 25862412
  12. Zinc transporter ZIP14 influences aspects of the pathophysiology of nonlethal polymicrobial murine sepsis induced by cecal ligation/puncture through zinc delivery. PMID: 26272258
  13. Oral cadmium chloride administration to ZIP14 knockout mice results in time dependent changes in gene expression. PMID: 25294218
  14. ZIP14 is a basolaterally localized protein in enterocytes and is involved in endosomal trafficking of zinc and is necessary for proper maintenance of intestinal tight junctions PMID: 25428902
  15. Hepatic ZIP14 protein levels are upregulated in iron-loaded hypotransferrinemic mice. PMID: 23349308
  16. We ligated mouse ZIP14A, ZIP14B and ZIP8 cDNA coding regions into the Xenopus-specific vector pXFRM, transcribed these in vitro, and microinjected the capped RNAs into Xenopus oocytes. K(m) and V(max) values for Cd, Zn and Fe uptake were determined. PMID: 23090441
  17. Zip14 expression induced by lipopolysaccharides in macrophages attenuates inflammatory response PMID: 23052185
  18. The knockdown of ZIP8, ZIP14 or DMT1 by siRNA transfection significantly reduced the uptake of Cd(2+) and Mn(2+) from the apical membrane. PMID: 22534978
  19. This study found that Zip14 is capable of mediating cellular uptake of nontransferrin-bound iron characteristic of iron-overload conditions. PMID: 21653899
  20. data highlight SLC39A14 as an important novel player in GPCR-mediated signaling PMID: 21445361
  21. These results suggest that endosomal ZIP14 participates in the cellular assimilation of iron from transferrin, thus identifying a potentially new role for ZIP14 in iron metabolism. PMID: 20682781
  22. SLC39A14 plays a role as a zinc transporter during the early stages of adipogenesis PMID: 15794747
  23. Zip14 expression is up-regulated through IL-6 PMID: 15863613
  24. Zip14 can mediate the uptake of zinc and non-transferrin-bound iron into cells. PMID: 16950869
  25. The present study provides the complete characterization of Slc39a14 gene and its ZIP14 mRNAs and proteins and for the first time demonstrates the significance of ZIP14 in Cd2+-mediated cell damage. PMID: 18270315
  26. These results suggest that signaling pathways activated by nitric oxide are factors in the upregulation of Zip14, which in turn mediates hepatic zinc accumulation and hypozincemia during inflammation and sepsis. PMID: 19179618

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein. Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Protein Families
ZIP transporter (TC 2.A.5) family
Tissue Specificity
Widely expressed. Highly and transiently expressed during the early stage of adipocyte differentiation. Strongly expressed in liver, preadipocyte, duodenum and jejunum, moderately in brain, heart, skeletal muscle, spleen, pancreas, kidney and white adipos
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1