Recombinant Mouse cGMP-gated cation channel alpha-1(Cnga1)

Code CSB-CF005642MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Cnga1
Uniprot No. P29974
Alternative Names Cnga1; Cncg; Cncg1; cGMP-gated cation channel alpha-1; Cyclic nucleotide-gated cation channel 1; Cyclic nucleotide-gated channel alpha-1; CNG channel alpha-1; CNG-1; CNG1; Cyclic nucleotide-gated channel, photoreceptor; Rod photoreceptor cGMP-gated channel subunit alpha
Species Mus musculus (Mouse)
Expression Region 1-684
Target Protein Sequence MKTNIINTWHSFVNIPNVIVPAIEKEIRRMENGACSSFSDDDNGSLSEESENEDSFFRSN SYKRRGPSQREQHLPGTMALFNVNNSSNKDQEPKEKKKKKKEKKSKADDKNENKKDPEKK KKKEKEKEKKKKEEKTKEKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNWTMIIARAC FDELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDRMKLIEKYKANLQFKL DVLSVIPTDLLYIKFGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIV IIIHWNACVYYSISKAIGFGNDTWVYPDVNDPEFGRLARKYVYSLYWSTLTLTTIGETPP PVLDSEYIFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSK DMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLL VELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEIS ILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGL LDINIANMGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFLKP LIETEFSALEEPGGESELTESLQD
Protein Length Full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Subunit of the rod cyclic GMP-gated cation channel, which is involved in the final stage of the phototransduction pathway. When light hits rod photoreceptors, cGMP concentrations decrease causing rapid closure of CNGA1/CNGB1 channels and, therefore, hyperpolarization of the membrane potential.
Gene References into Functions
  1. Numb protein interacts with Cnga1 in rod photoreceptor cilia to promote delivery of Cnga1. PMID: 25319694
  2. Insulin receptor (IR), an integral membrane protein, directly phosphorylates the CNGA1 subunit of CNG channels that in turn affects the function of these channels negatively. CNGA1 is a direct substrate of IR. PMID: 23032687
  3. that effective knockdown of GUCY2E and CNGA1 expression to counteract loss of PDE6 function may develop into a valuable approach for treating some patients with RP. PMID: 20950332
  4. Interaction with auxiliary subunit tetratricopeptide repeat-containing Rab8b-interacting protein (TRIP8b) is a major mechanism underlying proper expression of hyperpolarization-activated cyclic nucleotide-gated (HCN) channels and Ih in vivo. PMID: 21593326
  5. Grb14 is a normal physiological modulator of CNG channel function in vivo. PMID: 20890309
  6. We demonstrate the association of photoreceptor CNG channels with membrane domains enriched in raft lipids and indicates, for the first time, that raft lipids modulate the plasma membrane localization and functional activity of photoreceptor CNG channels. PMID: 18303857

Show More

Hide All

Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGA1 subfamily
Tissue Specificity Rod cells in the retina and inner medulla of kidney.
Database Links

KEGG: mmu:12788

STRING: 10090.ENSMUSP00000084464

UniGene: Mm.436652

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1