Recombinant Mouse p53 apoptosis effector related to PMP-22 (Perp)

Code CSB-CF872865MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Perp; Krtcap1; p53 apoptosis effector related to PMP-22; Keratinocyte-associated protein 1; KCP-1
Species
Mus musculus (Mouse)
Expression Region
1-193
Target Protein Sequence
MLRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSNHIQTSSLWWRCFDEGGGSGS YDDGCQSLMEYAWGRAAAATLFCGFIILCICFILSFFALCGPQMLVFLRVIGGLLALAAI FQIISLVIYPVKYTQTFRLHDNPAVNYIYNWAYGFGWAATIILIGCSFFFCCLPNYEDDL LGAAKPRYFYPPA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway.
Gene References into Functions
  1. Perp might play important roles in the formation and integration of stellate reticulum, dental lamina structure and enamel formation PMID: 24865245
  2. an important role for Perp in normal mammary tissue function and in mammary cancer suppression PMID: 22515648
  3. Data show that PERP is necessary for the integrity of the ameloblast-SI interface and that a lack of Perp causes downregulation of genes that are required for proper enamel formation. PMID: 21285247
  4. Studies suggest that Perp-deficiency promotes cancer by enhancing cell survival, desmosome loss, and inflammation, and they highlight a fundamental role for Perp and desmosomes in tumor suppression. PMID: 20975948
  5. In contrast to p53 shRNAs, PUMA shRNAs were unable to cooperate with oncogenic ras in transformation PMID: 15192153
  6. Perp is a key effector in the p63 developmental program. PMID: 15797384
  7. Perp is required for efficient skin carcinogenesis and suggest a role for intact cell-cell adhesion in supporting tumor development in these settings. PMID: 16061634
  8. Perp's requirement for both viability and epithelial integrity reflects a role in the stratified epithelial compartment. PMID: 16417219
  9. Perp is requered throughout adult life for proper epithelial homeostasis and function. PMID: 16485031
  10. pemphigus vulgaris autoantibodies disrupt Perp expression at the membrane and trigger its internalization along with DSG3 into the endosomal pathway, where it is ultimately targeted to the lysosome for degradation PMID: 19158843
  11. A paper describing the identification of Perp (p53 Apoptosis Effector Related to PMP22). Perp was found as a novel target gene of the p53 tumor suppressor, which is selectively induced during apoptosis compared to cell cycle arrest. PMID: 10733530

Show More

Hide All

Subcellular Location
Cell junction, desmosome. Cell membrane; Multi-pass membrane protein.
Protein Families
TMEM47 family
Tissue Specificity
Expressed in the stratified squamous skin epithelium of the skin and the tongue, but not in simple epithelia (at protein level). Expressed in apoptotic cells.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1