Recombinant Mouse p53 apoptosis effector related to PMP-22(Perp)

Code CSB-CF872865MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9JK95
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MLRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSNHIQTSSLWWRCFDEGGGSGS YDDGCQSLMEYAWGRAAAATLFCGFIILCICFILSFFALCGPQMLVFLRVIGGLLALAAI FQIISLVIYPVKYTQTFRLHDNPAVNYIYNWAYGFGWAATIILIGCSFFFCCLPNYEDDL LGAAKPRYFYPPA
Source in vitro E.coli expression system
Gene Names Perp
Protein Names Recommended name: p53 apoptosis effector related to PMP-22 Alternative name(s): Keratinocyte-associated protein 1 Short name= KCP-1
Expression Region 1-193
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway.
Subcellular Location Cell junction, desmosome, Cell membrane, Multi-pass membrane protein
Protein Families TMEM47 family
Tissue Specificity Expressed in the stratified squamous skin epithelium of the skin and the tongue, but not in simple epithelia (at protein level). Expressed in apoptotic cells.
Database Links

KEGG: mmu:64058

STRING: 10090.ENSMUSP00000019998

UniGene: Mm.28209

Pathway p53 signaling pathway

Related Products

Perp Proteins

Perp Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.