Alternative Names
            
              mt-co3; coiii; coxiii; mtco3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
             
           
                                        
            Species
            Oncorhynchus nerka (Sockeye salmon) (Salmo nerka)
           
                                        
                              
            Target Protein
              Sequence            
            MAHQAHAYHMVDPSPWPLTGAIAALLLTSGTAVWFHFHSLTLLTLGNVLLLLTMYQWWRD
IIREGTFQGHHTPPVQKGLRYGMILFITSEVFFFLGFFWAFYHASLAPTPELGGCWPPTG
ITTLDPFEVPLLNTAVLLASGVTVTWAHHSIMEGERKQTIQALTLTILLGFYFTFLQGME
YYEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQVQYHFTSEHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS            
           
                                        
            Protein Length
            full length protein
           
                              
            Tag Info
             Tag type will be determined during the manufacturing process.
              The tag type will be determined during production process. If
                you have specified tag type, please tell us and we will develop the specified tag preferentially.
              
             
                    
            Form
            
                            Lyophilized powder                             
              Note: We will preferentially ship the format that
                we have in stock, however, if you have any special requirement for the format, please remark your
                requirement when placing the order, we will prepare according to your demand.
                          
           
                              
            Buffer before Lyophilization
            
              Tris/PBS-based buffer, 6%
              Trehalose.            
           
                                        
            Reconstitution
            
              We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the
              bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We
              recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at
              -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
            
           
                    
                    
            Storage Condition
            Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
              repeated freeze-thaw
              cycles.
           
                              
            Shelf Life
            The shelf life is related to many factors, storage state, buffer ingredients, storage
              temperature
              and the stability of the protein itself.
              Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
              form is 12 months at -20°C/-80°C. 
           
                    
            Lead Time
            Delivery time
              may differ from different purchasing way or location, please kindly consult your local distributors
              for specific delivery time.
              Note: All of our proteins are default shipped with
                normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
                and extra fees will be charged.            
           
                    
            Notes
            Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
           
                    
            Datasheet
             Please contact us to get it.