Recombinant Pongo abelii NADPH oxidase 4(NOX4)

Code CSB-CF015961PYX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5R5C5
Storage Buffer Tris-based buffer,50% glycerol
Species Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Sequence MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRAS ASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHV AAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTY AIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLP EYFSEHFHEPFPEGFSKPEEFTQNTFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLY RYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCP TETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLH NKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGK TVGVFCCGPNSLSKTLHKLSNQINSYGTRFEYNKESFS
Source in vitro E.coli expression system
Gene Names NOX4
Protein Names Recommended name: NADPH oxidase 4 EC= 1.6.3.-
Expression Region 1-578
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein, Cell junction, focal adhesion, Cell membrane
Database Links

KEGG: pon:100171782

STRING: 9601.ENSPPYP00000004298

UniGene: Pab.19389

Pathway Lipids and Inflammation in Atherogenesis
Nitric oxide signaling
AGE-RAGE signaling pathway in diabetic complications

Related Products

NOX4 Proteins

NOX4 Proteins for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.