Recombinant Rat Corticotropin-releasing factor receptor 2 (Crhr2)

Code CSB-CF005966RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Crhr2; Crf2r; Corticotropin-releasing factor receptor 2; CRF-R-2; CRF-R2; CRFR-2; Corticotropin-releasing hormone receptor 2; CRH-R-2; CRH-R2
Species
Rattus norvegicus (Rat)
Expression Region
18-411
Target Protein Sequence
LAEELLLDGWGEPPDPEGPYSYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTR NAYRECLENGTWASRINYSHCEPILDDKQRKYDLHYRIALIINYLGHCVSVVALVAAFLL FLVLRSIRCLRNVIHWNLITTFILRNITWFLLQLIDHEVHEGNEVWCRCVTTIFNYFVVT NFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIVAWAVGKLYYENEQCWFG KEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLP LLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRSALRKRWHRW QDHHALRVPVARAMSIPTSPTRISFHSIKQTAAV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for CRH (corticotropin-releasing factor), UCN (urocortin), UCN2 and UCN3. Has high affinity for UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels.
Gene References into Functions
  1. Significantly higher CRF1 and CRF2 receptor levels after sensitization were detected in the Hippocampus. Additionally, CRF2 receptor levels were augmented by sensitization in the PreFrontal Cortex, and treatment and time-induced increases were detected in the Dorsal Striatum. PMID: 29857328
  2. CRF2 signaling could modulate intestinal epithelial cell differentiation. These mechanisms could be relevant to the stress induced epithelial alterations found in inflammatory bowel diseases. PMID: 28811708
  3. The results suggest that one of the mechanisms of the CRF-induced analgesic effect may be mediated by CRF-R2 receptors located in periaquaductal gray matter PMID: 27779480
  4. CRFR2 was elevated 3-7days following the auditory stimulus in rats. PMID: 27538655
  5. Water avoidance stress induced visceral hyposensitivity through peripheral CRF receptor type 2 and central dopamine D2 receptor, but not through opioid pathways PMID: 26662216
  6. UCN2 can modulate electrical remodeling of the myocardium and hemodynamics in an experimental model of spontaneous hypertensive rat via inhibition of L-type calcium channel and CRFR2 in cardiomyocytes PMID: 25712670
  7. In the hippocampus and hypothalamus, CRH-R2 mRNAs did not change despite acute or chronic noise stress in this study. PMID: 26333123
  8. Rats undergoing withdrawal showed increased anxiety-like behavior, which was reduced by ventricular infusion of the CRF2 antagonist antisauvagine-30 (ASV 2 mug/2 mul). PMID: 25205625
  9. Peripheral CRF2 activation induces colonic hyperemia through nitric oxide synthesis, without involving prostaglandin synthesis or sensory nerve activation. PMID: 25701320
  10. estrogens act on ERalpha to up-regulate CRHR2 expression in cardiomyocytes. PMID: 24035863
  11. Estrogens maintain CRHR2 expression in myocardium, which may through an epigenetic mechanism, and enhance UCN-induced cardioprotective effects against I/R injury. PMID: 23962778
  12. CRF(2) may have a modulatory action to CRF(1) signaling in gastric motor activity. PMID: 23205497
  13. Npy and Crfr2 have been previously identified as candidate genes of interest underlying the chromosome 4 QTL for alcohol consumption in inbred alcohol-preferring and inbred alcohol-nonpreferring rats. PMID: 23312492
  14. The hypothalamic expression CRF)-R was modulated by the feeding states in lean but not obese rats. PMID: 22227020
  15. CRHR2 activation decrease collapsin response mediator protein 3 expression in hippocampal neurons via a mechanism that is dependent on phospholipase/PKC signaling pathways. PMID: 22245585
  16. CRH-R2 mRNA expression was significantly lower in the basomedial amygdala of male PNS (prenatally stressed) rats compared with controls, but greater in female PNS rats, with no change in the basolateral amygdala or medial amygdala in either sex. PMID: 21854167
  17. These data support a model in which an excess in CRF(1) receptor activation, combined with reduced CRF(2) receptor signaling, may contribute to stronger expression of anxiety-like responses. PMID: 21376756
  18. Knockdown of corticotropin-releasing factor 2 by RNA interference during colitis significantly decreased the macroscopic lateral spread of ulceration PMID: 21330446
  19. The pseudo signal peptide of the corticotropin-releasing factor receptor type 2a decreases receptor expression and prevents Gi-mediated inhibition of adenylyl cyclase activity. PMID: 20682782
  20. Type 2 CRF receptors in the VMH mediate some of the central effects of Ucn 3, and the arcuate nucleus melanocortin system may be a downstream target of VMH CRFR2 neurons. PMID: 19952342
  21. These results indicated that endogenous CRF and/or related ligands that were released in the MRN could activate the CRF(2) receptor and stimulate serotonin release in the ventral hippocampus, thereby inducing fear memory retrieval. PMID: 20072117
  22. Urocortin 1 prevents indomethacin-induced small intestinal lesions, and that this action is mediated by the activation of CRFR2 and is functionally associated with the suppression of the intestinal hypermotility response caused by indomethacin. PMID: 19707872
  23. despite adult-like effects of leptin on POMC, neuropeptide Y, and corticotropin releasing factor receptor-2 expression in neonates, leptin does not regulate food intake during early development PMID: 12446596
  24. CRF receptor 2 in the anterior pituitary might be involved in the regulation of gonadal functions under stress. PMID: 12639937
  25. in mediating the ACTH response to shocks, alcohol and LPS, the influence of CRF(2) receptor remains subtle. PMID: 12746300
  26. Localization in cerebellar afferents implies pre-synaptic control of release of CRF-like ligands, impacting on sensory information being transmitted from afferents. Membrane bound at synapse. Role modulating afferent inputs. PMID: 12911751
  27. described for the first time a novel activity of the CRF2R, modulation of skeletal muscle mass PMID: 12959937
  28. At midlevels, CRF-R2 mRNA is expressed exclusively in serotonin neurons of the dorsal raphe, whereas at caudal levels approximately half the CRF-R2 mRNA is expressed in GABAergic neurons. PMID: 15174080
  29. No expression of CRF2 receptor transcripts was observed in the paraventricular nucleus, either in basal conditions or after TNBS induced colitis PMID: 15178552
  30. CRF-R2 mediates, at least in part, restraint stress-induced inhibition of LH pulses and may play a pivotal role in the normal physiological response of stress-induced suppression of the hypothalamic GnRH pulse generator and hence the reproductive system. PMID: 15388651
  31. ligand binding properties of CRFR2 PMID: 15652653
  32. The CRF2-mediated depression of excitatory transmission observed in control animals was switched to facilitation after withdrawal from chronic cocaine administration. PMID: 15659593
  33. study demonstrated that p38 MAP kinase is involved in the down-regulation of CRFR2beta mRNA levels induced by Ucn1, while anisomycin leads to up-regulation of this receptor mRNA levels in A7r5 aortic smooth muscle cells PMID: 15664670
  34. Changes in gastric motility induced by IV injection of des-acyl ghrelin were completely antagonized by ICV injection of a selective corticotropin-releasing factor (CRF) 2 receptor antagonist PMID: 16012930
  35. Urocortin 2, or another CRF-related neuropeptide acting at CRF2 receptors, modulates physiological and behavioral responses to stress-related stimuli via actions on a specific subset of serotonergic neurons within the dorsal raphe nucleus. PMID: 16403469
  36. Distinct isoforms of the corticotropin releasing factor receptor are present in the cerebellum, supporting a concept that corticotropin releasing factor modulaties activity in cerebellar circuits and ultimately in controlling motor behavior. PMID: 16413121
  37. Results provide the first detailed analysis of the cellular localization of the full-length form of corticotropin releasing factor receptor 2 in rat cerebellum during early postnatal development. PMID: 16820012
  38. Hypoglycemia and lipopolysaccharide stress-induced LH suppression involves activation of CRF(2) while restraint stress-induced inhibition of LH pulses involves both CRF(1) and CRF(2). PMID: 16867181
  39. The results implicate the VMN and PVN of the hypothalamus as sites for Ucn 3-CRF(2) control of food intake. PMID: 17019404
  40. Presence of a prominent CRF2 signaling system in the esophagus suggesting a functional role in secretomotor activity and epithelial and muscle cell proliferation. PMID: 17218420
  41. Opposing role of the CRF(2) receptor subtype within the central nucleus of the amygdal in mediating ethanol self-adminstration withdrawal. PMID: 17512918
  42. A CRHR-2-mediated mechanism in the brain stimulates corticotropin-releasing hormone- and arginine vasopressin-producing neurons in parvocellular paraventricular nucleus, resulting in plasma adrenocorticotropic hormone secretion. PMID: 17551262
  43. These findings suggest that CRH-R2 mediates orexin A-induced LH suppression and it is possible that CRH and UcnII in the hypothalamus are involved in this pathway. PMID: 17680889
  44. Peripheral and central administration of exogenous urocortin 1 disrupts the fasted motility pattern of the small intestine in rats via the corticotrophin releasing factor receptor 2 and a cholinergic mechanism. PMID: 17944898
  45. Presynaptic CRF2 receptor-mediated inhibition does not reach behavioral significance. PMID: 18400885
  46. Amphetamine treatment increased CRF(2) receptor densities in most subregions of the dRN, and CRF(2) receptors were still elevated following 6 weeks of withdrawal. PMID: 18585412
  47. Antagonism of CRF receptor type 2 but not CRF receptor type 1 in the dorsal raphe nucleus abolished CRF-induced increases in medial prefrontal cortex serotonin. PMID: 18702701
  48. glucocorticoid receptors and CRF-2 receptors participate in the CRF-induced analgesic effect. PMID: 19065825
  49. purified recombinant UCN II protein specifically binds to CRF receptor 2 in rat ROS 17/2.8 and GH3 cells PMID: 19334530
  50. The results indicate CRF(2) receptor-positive neurons in the posterior medial amygdala are involved in the neural response to social defeat. PMID: 19358876

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Predominantly expressed in limbic regions of the brain such as the lateral septum, the entorhinal cortex, the hypothalamic ventromedial nucleus and several amygdaloid nuclei. Also detectable in lung, kidney and heart.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1