Recombinant Rat D (3) dopamine receptor (Drd3)

Code CSB-CF007180RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Drd3
Uniprot No.
Alternative Names
Drd3; D(3 dopamine receptor; Dopamine D3 receptor
Species
Rattus norvegicus (Rat)
Expression Region
1-446
Target Protein Sequence
MAPLSQISTHLNSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYIVLRQRQRKRILTRQNSQCISIRPGFPQ QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKQYPQKCQDPLLSHLQPPSPGQTHGGLK RYYSICQDTALRHPSLEGGAGMSPVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLRLGP LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV NSALNPVIYTTFNVEFRKAFLKILSC
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.
Gene References into Functions
  1. BDNF participates in the regulation of the dopamine system by acting on DRD3 and DAT. PMID: 28598964
  2. Renal D3 receptor regulates the expression and function of D4 receptor in renal proximal tubule cells via PLC /PKC signaling pathway. PMID: 27254310
  3. We encountered significant differences in the effect of neonatal lesion in the ventral hippocampus on drd2 and drd3 mRNA expression levels among the brain regions analyzed in rat adulthood. These findings suggest that expression levels of some dopamine receptors may be regulated during adulthood, leading to behavioral and neurochemical changes associated with schizophrenia. PMID: 28096775
  4. D3 and D1-D3 receptor heteromers were increased in 6-OHDA-hemilesioned rats rendered dyskinetic by treatment with L-DOPA which activates D3 receptors thus making right and left striatal D1 receptors equally responsive to dopamine. PMID: 25344317
  5. Results show that risk-aversion induced by chronic stress is associated to reduced dopamine levels in orbitofrontal cortex and that this impairments on decision-making can be reverted with DRD2/DRD3 agonists PMID: 26233608
  6. let-7d may induce DRD3 repression in a transcriptional manner by means of DNMTs dependent DNA methylation and histone modification. PMID: 26802971
  7. in combination with angiotensin II type 2 receptors enhances natriuresis and diuresis via ERK1/2-MAPK pathway PMID: 25770092
  8. Study found a significant association with disordered gambling and rs167771 (DRD3) and with rs381572 (CAMK2D) in humans; results regarding DRD3 were supported by results from animal experiments PMID: 25266122
  9. Highlights a requirement for dopamine D3 signaling in the development of adolescent nicotine sensitization, suggesting it may represent an appropriate target in the prevention of nicotine dependence initiated at this age. PMID: 25907750
  10. Suggest that activation of D3R, by decreasing Galpha12-induced renal damage, may exert a protective effect from renal I/R injury. PMID: 25989500
  11. Results reveal that in addition to enhancing signaling through the cAMP/PKA cascade, dopamine denervation switches the D3R signaling cascade and depresses CaMKII control in nigral projections of medium spiny neurons PMID: 25517101
  12. Dopamine D3 receptor was found to be an essential component of the molecular pathways underlying the reinforcing properties of alcohol. PMID: 25257287
  13. Dopamine D3 (and D2) availability was inversely related to baseline D2/3 receptor availability in the ventral striatum of high-impulsive rats. PMID: 23399948
  14. The findings indicate that impulsivity and hyperactivity are separately regulated by core and shell sub-regions of the nucleus accumbens and that high impulsive rats show an enhanced response to D2/3 receptor activation in these regions PMID: 23407782
  15. Inhibition of vasopressor sympathetic quinpirole-induced outflow in pithed rats is mediated predominantly by dopamine D3 receptors. PMID: 23420100
  16. Dopaminergic transmission through D1, D2, and D3 receptors appears necessary for spontaneous ultrasonic calling in rats PMID: 23192317
  17. Stimulation of D(3) receptor may contribute to the production of the discriminative stimulus effect induced by U-50,488H. PMID: 21054688
  18. D3 dopamine receptor regulates D5 receptor expression and function in renal proximal tubule cells PMID: 22297482
  19. The results of this study suggested that D2R and D3R, expressed in the NAcc, have both shared and non-overlapping roles in transduction of alerting signals elicited by potentially important sensory and environmental cues. PMID: 22394078
  20. RGS4 exerted potent inhibitory activities on the signaling of D(2)R/D(3)R. PMID: 21896332
  21. An imbalance in the striatal expression of dopamine D3 receptor and its splice variant D3nf accompany enhanced dopamine D3 activity. PMID: 21389298
  22. The inhibitory constants of compounds with different selectivities for D2 and D3 receptors have been determined in striatal and cerebellar membrane preparations using t[(3)H]-tritiated PHNO (naxagolide) and [(3)H]-tritiated raclopride as radioligands. PMID: 20936685
  23. It was concluded that a D3 receptor interaction with Galpha12/Galpha13 that increases sodium excretion may have a role in the regulation of blood pressure. PMID: 21633357
  24. ETB receptors regulate and physically interact with D receptors differently in WKY rats and SHRs. The impaired natriuretic effect in SHRs may be, in part, related to impaired ETB and D receptor interactions. PMID: 21228598
  25. Dopamine D3 receptor (and D2) interacts with nociceptin in the substantia nigra in this animal model of Parkinson's disease. PMID: 21215744
  26. Increased D3 DAR surface expression on cocaine withdrawal day45 may contribute to enhanced cocaine-seeking after prolonged withdrawal. PMID: 20435100
  27. Suggest that D(3)R might mediate the protective response to serum deprivation in malignant peripheral nerve sheath tumor cells through the inhibition of NF1 gene expression. PMID: 20811714
  28. The results suggest that peripheral dopamine D2 receptors and, at least in part, dopamine D3 and central dopamine D2/D3 receptors play an important role in the regulation of gastric motility in rats. PMID: 20888837
  29. The properties of D(2)/D(3) receptor agonists, to reinstate food seeking at larger doses, and to potentiate food-primed response reinstatement at lower doses, are preferentially mediated by D(2) rather than by D(3) receptors PMID: 12525958
  30. The present findings confirm the importance of the D3 receptor in the expression of behavioural sensitization to levodopa in animals with dopaminergic denervation. PMID: 12535962
  31. D3-preferring agonists could affect the reward mechanisms of the brain, however, modulation of D3 receptor function does not appear to be a significant mechanism for modifying the place conditioning effect of cocaine. PMID: 12544838
  32. the affinities of cabergoline (Ki=1.27 nM), lisuride (Ki=1.08 nM) and pergolide (Ki=0.86 nM) for the D3 receptor subtype were comparable to that of pramipexole (Ki=0.97 nM). PMID: 14523624
  33. no support for the notion that the dopamine D3 receptor system is involved in the pathogenesis of hypertension in the SHR model. PMID: 14621190
  34. Unlike in 6-hydroxydopamine-treated rats, in zitter mutant rats administered L-dopa does not reverse the loss of BDNF mRNA or lead to an elevation of dopamine D(3) receptor number PMID: 15081599
  35. Analysis of the rat dopamine D3 receptor revealed 10 polymorphisms in the 5'flanking region and four polymorphisms in intronic regions of the gene. PMID: 15140009
  36. D3 dopamine receptor is found to be expressed in the subcommissural organ (SCO), an ependymal brain gland that is located in the roof of the third ventricle. PMID: 15197646
  37. DA receptors have a function on blasts as they enter the brain, focusing on the D3 dopamine receptor (D3R) as a representative dopaminergic receptor PMID: 15319371
  38. D3 receptors are expressed in subventricular zone(SVC) cells, some of which are engaged in neuronal fate. D3 receptor-mediated mitogenic activity is probably at origin of SVC cell division. PMID: 15584906
  39. this study mapped the distribution of central DA-2 and DA-3 receptors in Wistar-Kyoto and Wistar rats PMID: 16574158
  40. One mechanism of hypertension may be related to increased renal expression of AT(1) receptors due decreased D(3) receptor regulation. PMID: 16902178
  41. Long-term alcohol consumption leads to an up-regulation of the dopamine D3R that may contribute to alcohol-seeking and relapse. PMID: 17077299
  42. Alterations of dopamine D3 receptors are involved in the behavioral phenotype of the ci3 rat; this substantiates a recent genetic linkage analysis that indicated the D3 receptor gene as a candidate gene in this rat mutant. PMID: 17187934
  43. findings demonstrated that D2/3 receptor availability is significantly reduced in the nucleus accumbens of impulsive rats that were never exposed to cocaine and that such effects are independent of DA release PMID: 17332411
  44. Effect of D3 receptor activation on novelty-induced locomotor activity in these two strains of rats. PMID: 17952413
  45. the findings lend support to the hypothesis that dopamine D3 receptors play a role in the expression of conditioned fear PMID: 17996231
  46. Report the inhibitory effect of D1-like and D3 dopamine receptors on norepinephrine-induced proliferation in vascular smooth muscle cells. PMID: 18441198
  47. D(3) receptors physically interact with proximal tubule ETB receptors and the blunted natriuretic effect of dopamine in SHRs may be explained, in part, by abnormal D(3)/ETB receptor interactions. PMID: 18547994
  48. Enhanced cortical responsiveness to psychostimulants occurs via a reduction in D3 receptors, which reduces drug-seeking behavior. There is evidence for a postnatal sensitive period when juvenile MPH exposure is able to alter cortical development. PMID: 18588536

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Mainly in limbic areas of brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1