Recombinant Rat Epithelial cell adhesion molecule(Epcam)

Code CSB-CF007717RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O55159
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence QKDCVCNNYKLTSRCYENENGECQCTSYGTQNTVICSKLASKCLVMKAEMTHSKSGRRMKPEGAIQNNDGLYDPECDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERAQPYNFESLHTALQDTFASRYMLNPKFIKSIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGELLDLDPGQTLIYYVDEKAPEFSMQGLTAGIIAVIVVVVLAVIAGIVVLVISTRKRSAKYEKAEIKEMGEIHRELNA
Source in vitro E.coli expression system
Gene Names Epcam
Protein Names Recommended name: Epithelial cell adhesion molecule Short name= Ep-CAM Alternative name(s): Epithelial glycoprotein 314 Short name= EGP314 Protein D5.7A Tumor-associated calcium signal transducer 1 CD_antigen= CD326
Expression Region 24-315
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E (By similarity).
Subcellular Location Lateral cell membrane, Single-pass type I membrane protein, Cell junction, tight junction
Protein Families EPCAM family
Database Links

KEGG: rno:171577

STRING: 10116.ENSRNOP00000021135

UniGene: Rn.106481

Related Products

Epcam Proteins

Epcam Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.