Recombinant Rat Fatty acid desaturase 2 (Fads2)

Code CSB-CF007960RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Fads2; Fadsd6; Acyl-CoA 6-desaturase; Delta(6 fatty acid desaturase; D6D; Delta(6 desaturase; Delta-6 desaturase; Fatty acid desaturase 2
Species
Rattus norvegicus (Rat)
Expression Region
1-444
Target Protein Sequence
MGKGGNQGEGSTELQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYNVTKWSQRHPGGHRVI GHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRGKSSQITEDFRALKKTA EDMNLFKTNHLFFFLLLSHIIVMESIAWFILSYFGNGWIPTVITAFVLATSQAQAGWLQH DYGHLSVYKKSIWNHIVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFV LGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIRRRDWVDLAWAI SYYARFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQMNHIVMEIDLDHYRDWFSSQL AATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL RALLDIVSSLKKSGELWLDAYLHK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors, acting as a fatty acyl-coenzyme A (CoA) desaturase that introduces a cis double bond at carbon 6 of the fatty acyl chain. Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleate (GLA) (18:3n-6) and stearidonate (18:4n-3), respectively. Subsequently, in the biosynthetic pathway of HUFA n-3 series, it desaturates tetracosapentaenoate (24:5n-3) to tetracosahexaenoate (24:6n-3), which is then converted to docosahexaenoate (DHA)(22:6n-3), an important lipid for nervous system function. It can also desaturate (11E)-octadecenoate (trans-vaccenoate) at carbon 6 generating (6Z,11E)-octadecadienoate. In addition to Delta-6 activity, this enzyme exhibits Delta-8 activity with slight biases toward n-3 fatty acyl-CoA substrates.
Gene References into Functions
  1. We first showed that both recombinant and native rat FADS2 were able to Delta6-desaturate not only the cis9- but also the cis12- and cis15-18:1 isomers. PMID: 25701799
  2. Delta-6-desaturase links polyunsaturated fatty acid metabolism with phospholipid remodeling and disease progression in heart failure. PMID: 24284026
  3. epigenetic regulation of Fads2 may contribute to short- and long-term regulation of PUFA synthesis PMID: 23107313
  4. Changes in progesterone and oestradiol during pregnancy may promote the synthesis of LC PUFA via increased FADS2 expression. PMID: 22495065
  5. Data show that an imbalance of maternal micronutrients increases Delta5 desaturase activity but decreases mRNA levels, decreases Delta6 desaturase activity but not mRNA levels as compared to control. PMID: 22133376
  6. Results show that delta-6 desaturase as well as elongase-6 expressions were upregulated in 3-month-old Zucker fatty rats as compared to lean littermates. PMID: 21172452
  7. Regulation of 6-desaturase expression is different in female vs. male liver (but not cerebral cortex) during n-3 fatty acid repletion. PMID: 19157821
  8. Delta6-desaturase acts on 24-carbon fatty acids in very-long-chain polyunsaturated fatty acid biosynthesis PMID: 11988075
  9. rat Delta 6-desaturase, which acts on the 18- and 24-carbon fatty acids of the n-6 and n-3 series, is also able to catalyze palmitic acid Delta 6 -desaturation PMID: 12562851
  10. n-6 and n-3 PUFAs suppressed the hepatic expression of Fads2 by inhibiting the rate of Fads2 gene transcription. In contrast, consumption of the PPARalpha activator WY 14,643 significantly enhanced the transcription of hepatic DeFads2 by 500%. PMID: 12562861
  11. testicular distribution of Delta5- and Delta6-desaturase and stearoyl-CoA desaturase 1 and 2 shows that all four desaturases seem to be localized in the Sertoli cells, with far lower expression in germ cells PMID: 12606372
  12. Using 6-mon-old eSS rats that had already developed insulin resistance, we investigated the changes evoked on delta9, delta6, and delta5 liver desaturases PMID: 14577661
  13. The delta 6-desaturase activity was significantly increased, whereas gene expression tended to decrease. PMID: 15589689

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein.
Protein Families
Fatty acid desaturase type 1 family
Tissue Specificity
Expressed in the liver and brain (at protein level). Highest activity is found in the liver and adrenals followed by the testes and other organs, absent in adipose tissue.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1