Recombinant Rat G protein-activated inward rectifier potassium channel 1 (Kcnj3)

Code CSB-CF012056RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Kcnj3; Girk1; Kga; G protein-activated inward rectifier potassium channel 1; GIRK-1; Inward rectifier K(+ channel Kir3.1; KGA; KGB1; Potassium channel, inwardly rectifying subfamily J member 3
Species
Rattus norvegicus (Rat)
Expression Region
1-501
Target Protein Sequence
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILE GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMS STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG PTRMEGNLPAKLRKMNSDRFT
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This receptor plays a crucial role in regulating the heartbeat.
Gene References into Functions
  1. Transient activation of mGluRs decreased the GIRK current evoked by GABAB and D2 receptors, although less efficaciously for D2. PMID: 28009293
  2. Study provides evidence that Kir3.1 is involved in the pathogenesis of sinus bradycardia since its ihibition with siRNA can reverse the sinus bradycardia. PMID: 28205094
  3. Findings point to the unique vulnerability of the PFC to the nutritional insult during early brain development, with enduring effects in adulthood on KCNJ3 expression and baseline metabolic activity. PMID: 25446346
  4. Basal Kir3 current in a native environment is unrelated to G-protein signaling or agonist-independent free G-beta-gamma. PMID: 24576551
  5. Atrium-specific Kir3.x determines inducibility, dynamics, and termination of fibrillation by regulating restitution-driven alternans. PMID: 24065610
  6. siRNA knock-down of NgR1 resulted in a selective increase of GABAB R1 and GABAB R2 protein and an increase in GIRK1. PMID: 23829864
  7. The mechanisms of regulation of GIRK by Galpha(i/o) using wild-type Galpha(i3) (Galpha(i3)WT) and Galpha(i3), were investigated. PMID: 21795707
  8. The surface expression of neuronal GIRK channels is regulated by the psychostimulant-sensitive sorting nexin 27 (SNX27) protein through a class I PDZ-binding interaction. PMID: 21422294
  9. Mutating a GIRK1 N-terminal hydrophobic residue predicted to interact with the C-terminal domain decreases channel function & termini association. Its hydrophobic nature is critical for interaction of adjacent termini & is permissive for channel gating. PMID: 15716420
  10. a G protein-receptor kinase 2- and beta-arrestin 2-dependent internalization of the M(2) receptor into clathrin-coated vesicles could play a major role in I(K,ACh) desensitization PMID: 17012364
  11. I bir is a homotetrameric Kir3.4 channel current with novel properties of regulation and pharmacology. Ibir shares some properties with a basal current recently described in atrial myocytes from an animal model of atrial fibrillation (AF) and AF patients. PMID: 17884923
  12. study investigated structure and function of a new splice variant of GIRK1 isolated from rat brain; GIRK1d variant preferentially binds GIRK2 or GIRK4 over GIRK1; it largely reduces conductances mediated by GIRK1/2 or GIRK1/4 hetero-multimeric channels PMID: 18097938
  13. The results strongly demonstrate the differential developmental and hormonal regulation of GIRK(2) in the rat CNS. PMID: 18178009
  14. Data describe localization of GIRK1, GIRK2, and GIRK3 subunits and 5-HT(1A) receptor in rat brain, and their co-expression with markers of glutamatergic, gamma-aminobutyric acid (GABA)ergic, cholinergic, and serotonergic neurons. PMID: 18698588

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ3 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×