Recombinant Rat Histamine H1 receptor (Hrh1)

Code CSB-CF010737RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Hrh1; Histamine H1 receptor; H1R; HH1R
Species
Rattus norvegicus (Rat)
Expression Region
1-486
Target Protein Sequence
MSFANTSSTFEDKMCEGNRTAMASPQLLPLVVVLSSISLVTVGLNLLVLYAVHSERKLHT VGNLYIVSLSVADLIVGAVVMPMNILYLIMTKWSLGRPLCLFWLSMDYVASTASIFSVFI LCIDRYRSVQQPLRYLRYRTKTRASATILGAWFFSFLWVIPILGWHHFMPPAPELREDKC ETDFYNVTWFKIMTAIINFYLPTLLMLWFYVKIYKAVRRHCQHRQLTNGSLPSFSELKLR SDDTKEGAKKPGRESPWGVLKRPSRDPSVGLDQKSTSEDPKMTSPTVFSQEGERETRPCF RLDIMQKQSVAEGDVRGSKANDQALSQPKMDEQSLNTCRRISETSEDQTLVDQQSFSRTT DSDTSIEPGPGRVKSRSGSNSGLDYIKITWKRLRSHSRQYVSGLHLNRERKAAKQLGFIM AAFILCWIPYFIFFMVIAFCKSCCSEPMHMFTIWLGYINSTLNPLIYPLCNENFKKTFKK ILHIRS
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.
Gene References into Functions
  1. Data (including data from studies in knockout mice) suggest that sleep-promoting effect of dietary supplement rice bran is dependent on Hrh1 antagonism; rice bran fully inhibits Hrh1 agonist-induced increase in action potential frequency in tuberomammillary nucleus neurons. PMID: 28722302
  2. findings indicate that histamine H1, H2, and H3 receptors are present in rat olfactory epithelium and may play a physiological role in olfactory transmission. PMID: 28964277
  3. This study demonstrates that AITC-induced nociception in vivo depends on TRPA1 and is decreased by the blockade of the NK1 receptor for SP, the H1 receptor for histamine and the 5-HT1A and 3 receptors for 5-HT PMID: 27904941
  4. An H1 receptor blocker did not affect exercise-induced improvement in learning and memory in rats, so these receptors may not play a role in this process. PMID: 25192644
  5. Isolated rat mesenteric collecting lymphatics were treated with 1- to 100-muM histamine. Pharmacologic blockade of either H1 or H2 histamine receptors significantly inhibited the response to histamine. PMID: 24702851
  6. Activation of H1R was required dopaminergic lineage during ventral midbrain development. PMID: 25112718
  7. Na+-Ca2+ exchangers coupled to H1 receptors and hyperpolarization-activated cyclic nucleotide-gated channels linked to H2 receptors co-mediate the strong postsynaptic excitatory action of histamine on al vestibular nucleus neurons PMID: 23713466
  8. These results show that histamine, by activating H(1)R, has a neurogenic effect in clonal conditions PMID: 23497494
  9. Histamine within the nucleus tractus solitarii may play a role in regulating cardiovascular homeostasis via activation of H1 receptors. PMID: 21622829
  10. at the level of the hippocampus, histamine through its H1 and H2 receptors, mediates orofacial region pain PMID: 21602597
  11. H1 receptors play an excitatory role in the modulation of the discharge activities of the inspiratory neurons in neonatal rat brainstem slices. PMID: 20117984
  12. Based on its ability to reverse amphetamine-induced PPI deficits, blockade of histamine H(1) receptors seems to contribute to the therapeutic effect of the antipsychotic clozapine. PMID: 20811878
  13. Studies using various antagonists indicate hippocampal Hrh1 plays an important role in encoding, retention, and retrieval processes of spatial working memory. PMID: 20096284
  14. Activation of H1-receptors in vasopressinergic neurons results in downstream activation of NO synthase, which then mediates the H1-receptor effects. PMID: 12419527
  15. ThEA stimulation evoked amylase release via H1 receptor but was not followed by L-arginine/nitric oxide pathway activation. PMID: 12581497
  16. H1, H2, and H3 histamine receptor mRNA detected in modiolus but not in lateral and medial portions of the cochlea. First evidence of H1, H2, and H3 histamine receptor mRNA in rat cochlea. PMID: 12634496
  17. histamine H(1)-receptor and PKC are involved in the signal transduction pathway, responsible for histamine-stimulated NGF secretion from cultured astrocytes PMID: 15167971
  18. In rat thalamus, histamine H(1) receptor and isoforms of H(3) receptor were expressed predominantly in the midline and intralaminar areas PMID: 15899242
  19. Postischemic increase in H(1) receptor mRNA expression in the caudate-putamen. PMID: 16181737
  20. data represent the first demonstration of H1 receptor expression in sympathetic preganglionic neurons and suggest that histamine acts to regulate excitability of these neurons via a direct postsynaptic effect on H1 receptors PMID: 16354729
  21. Processing of proprioceptive information at the level of the mesencephalic trigeminal neurons is controlled via histamine H1 and H3 receptors through different postsynaptic mechanisms. PMID: 16797837
  22. Results suggest that hippocampal H1 receptors play an important role in working memory processes on radial maze performance and the decrease in hippocampal theta power is associated with the working memory deficit induced by the blocking of H1 receptors. PMID: 17562388
  23. Data show that the synergistic effect of histamine and IL-6 on NGF secretion from cultured astrocytes is evoked by histamine stimulation of IL-6 secretion via a H1-receptor-PKC-MAPK signalling pathway. PMID: 18345501
  24. Data show that cetirizine, a histamine H1 receptor antagonist, decreases the first stage of orthodontic tooth movement in rats. PMID: 18345503
  25. The expression of H1 receptor mRNA was up-regulated in the hypothalamus and brainstem, but not in the cerebral cortex after 2 G hypergravity load in rats. PMID: 18607976
  26. These results suggest that chewing-induced histamine release in the hippocampus and the subsequent H1 receptor activation may be essential to rescue stress-suppressed synaptic plasticity. PMID: 19393269

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1