Recombinant Rat KiSS-1 receptor (Kiss1r)

Code CSB-CF835670RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Kiss1r; Gpr54; KiSS-1 receptor; KiSS-1R; G-protein coupled receptor 54; G-protein coupled receptor OT7T175; rOT7T175; Kisspeptins receptor; Metastin receptor
Species
Rattus norvegicus (Rat)
Expression Region
1-396
Target Protein Sequence
MAAEATLGPNVSWWAPSNASGCPGCGVNASDGPGSAPRPLDAWLVPLFFAALMLLGLVGN SLVIFVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPTWVLGDFMCKFVNY IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALTVSLSIWVGSAAVSAPVLAL HRLSPGPHTYCSEAFPSRALERAFALYNLLALYLLPLLATCACYGAMLRHLGRAAVRPAP TDGALQGQLLAQRAGAVRTKVSRLVAAVVLLFAACWGPIQLFLVLQALGPSGAWHPRSYA AYALKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPCGPQRQRRPHASAHSDRAAPH SVPHSRAAHPVRVRTPEPGNPVRRSPSVQDEHTAPL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for metastin, a C-terminally amidated peptide of KiSS1. KiSS1 is a metastasis suppressor protein. Activation of the receptor inhibits cell proliferation and cell migration, key characteristics of tumor metastasis. The receptor is essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/KISS1R system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood. Analysis of the transduction pathways activated by the receptor identifies coupling to phospholipase C and intracellular calcium release through pertussis toxin-insensitive G(q) proteins.
Gene References into Functions
  1. These data indicate that ovarian Kiss1 and Kiss1r mRNA levels are increased on postnatal days 20 and 15, respectively, and that changes in the serum LH level and the ovarian sensitivity to LH may be involved in the alteration of ovarian Kiss1 mRNA levels. PMID: 28552864
  2. identify the neurochemical characteristics of approximately 78% of Kiss1r-expressing neurones in total. PMID: 27981646
  3. Hypogonadism lead to decrease of kisspeptins signaling in peripheral androgen-dependent tissues. Serum level of kisspeptins is physiologically low and, probably, it can not be used as a marker of activity of kisspeptins system. Efficacy of treatment with testosterone is not enough that is required a novel therapeutic resources. PMID: 29244919
  4. GnRH neurons may play an intermediate role in the activation and maintenance of the reproductive function regulated by the kisspeptin/kiss1r system. PMID: 27373140
  5. Kiss1R mRNA was expressed in the perinuclear zone-supraoptic nucleus, and the relative Kiss1R mRNA expression does not change over the course of pregnancy PMID: 27589336
  6. Alterations in Kiss1/GPR54 balance may account for both reproductive and metabolic abnormalities reported in obese and diabetic rats PMID: 26853724
  7. This study demonistrated that Kissir and Melanin-concentrating hormone colization in neuron in the lateral hypothalamus (LH) and zona incerta (ZI), but MCHR1 mRNA is widely expressed throughout the brain. PMID: 24978951
  8. We confirm the presence of Kiss1 and Kiss1r mRNA in the rat placenta with expression increasing over the final third of pregnancy, suggestive of a role in restricting placental growth PMID: 23684378
  9. The kisspeptin/GPR54 signaling system could stimulate progesterone secretion in rat luteal cells via the Erk1/2 mitogen-activated protein kinase signaling pathway. PMID: 23312234
  10. Kisspeptin and its receptor are expressed in the human, rat and mouse heart and kisspeptins possess potent positive inotropic activity. PMID: 22132116
  11. KISS1 and KISS1R expression in the human and rat carotid body and superior cervical ganglion. PMID: 22193294
  12. Data show that expression of kisspeptins and kisspeptin receptor are altered in the kidney tissues of chronic renal impairment, raising the possibility of their pathophysiological roles in chronic renal failure. PMID: 20621140
  13. These data show that Kiss1 was reduced at day 25 by food deprivation at postnatal day 25; Kiss1r was reduced by food deprivation on postnatal days 5 and 25. PMID: 20807723
  14. Hypothalamic KiSS-1/GPR54 system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood. PMID: 15242985
  15. KiSS-1/GPR54 system is a novel, pivotal downstream element in the neuroendocrine network governing gonadotropin secretion. PMID: 15637288
  16. KiSS-1 mRNA/metastin (kisspeptin-54) expression is inhibited in the arcuate nucleus by the suckling stimulus PMID: 17289848
  17. that GnRH receptor/GnRH and GPR54/kisspeptin autoregulatory systems are integrated by negative feedback to regulate GnRH and kisspeptin secretion from GnRH neurons PMID: 17698953
  18. KiSS-1 and GPR54 genes are co-expressed in rat gonadotrophs and differentially regulated in vivo by oestradiol and gonadotrophin-releasing hormone. PMID: 18208554
  19. KiSS1 expression is upregulated by neuronal activity and activation of GPR54 by kisspeptin may in turn contribute to sustain basal BDNF levels required for hippocampal function. PMID: 18834866
  20. Results suggest that the reduced Kiss1-Kiss1r expression may be a contributing factor in stress-related suppression of luteinizing hormone secretion. PMID: 19094090
  21. Data show that kiss1 and GPR54 are expressed in the small- to large-sized neurons in the L4/5 dorsal root ganglion of naive rats. PMID: 19111911
  22. Data show that Kiss1, but not Kiss1r mRNA, in the mPOA is down-regulated in pre-pubertal females, suggest that this population of neurons plays a pivotal role in controlling onset of puberty, and that their function can be affected by neonatal stress. PMID: 19500221

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highest expression levels in the cerebrum and cecum. Moderate expression in the ovary, colon and placenta. Low levels in the uterus, small intestine, and thymus. Expressed only moderately in the placenta. No expression in kidney tissues. Has a complex and
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1