Recombinant Rat Mitochondrial brown fat uncoupling protein 1 (Ucp1)

Code CSB-CF025554RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Ucp1; Slc25a7; Ucp; Mitochondrial brown fat uncoupling protein 1; UCP 1; Solute carrier family 25 member 7; Thermogenin
Species
Rattus norvegicus (Rat)
Expression Region
2-307
Target Protein Sequence
VSSTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGT ITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGRETPASLGSKISAGL MTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNL MRNVIINCTELVTYDLMKGALVNHHILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFI NSLPGQYPSVPSCAMTMYTKEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQLKKELMKSRQ TVDCTT
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance. Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria.
Gene References into Functions
  1. The expression of peroxisome proliferator-activated receptor gamma coactivator 1alpha (PGC-1alpha) and uncoupling protein (UCP)-1 in brown adipocytes. PMID: 27686967
  2. e found that CPT1AM-expressing rBA have increased FAO, lipolysis, UCP1 protein levels and mitochondrial activity. Additionally, enhanced FAO reduced the palmitate-induced increase in triglyceride content and the expression of obese and inflammatory markers. Thus, CPT1AM-expressing rBA had enhanced fat-burning capacity and improved lipid-induced derangements. PMID: 27438137
  3. The history of discovery of UCP1, the mitochondrial uncoupling protein of brown adipocyte, has been described. (Review) PMID: 27916641
  4. In the absence of regulators (fatty acids, retinoids), rodent UCP1 presents a high ohmic proton conductance that cannot be detected in human UCP1. PMID: 27750036
  5. Data indicate that prolonged cold exposure may induce anti-inflammatory response in mesenteric white adipose tissue associated with induction of UCP-1 expression. PMID: 27560796
  6. results suggest that modulation of serotonin system results in positive modulation of UCP and mitochondrial bioenergetics in brown fat tissue. PMID: 26129910
  7. Data suggest that expression of Ucp1 in brown adipose tissue (BAT) of fetal/neonatal pups is regulated by maternal dietary factors; here, maternal low-protein diet up-regulates expression of Ucp1 and reduces birth weight of obesity-prone male pups. PMID: 25858881
  8. Vitamin D deficiency decreases adiposity in rats and causes altered expression of uncoupling proteins and steroid receptor coactivator3 PMID: 25132457
  9. An ERRgamma inverse agonist reduces UCP1 expression in brown adipocytes. PMID: 23404793
  10. there is a role for ubiquitinylation and the cytosolic proteasome in turnover of mitochondrial UCP1. PMID: 22531154
  11. Data suggest that interscapular brown adipose tissue plays important role in burn injury-induced hypermetabolism through its morphological changes and expression of Ucp1. PMID: 23169784
  12. Endurance training blocked the high-sugar diet induced up-regulation of UCP1 expression in interscapular brown adipose tissue, whereas it up-regulated the expression of Ucp3 mRNA in muscle. PMID: 23084644
  13. Fatty acids and nucleotides compete to regulate the activity of UCP1. PMID: 22952235
  14. Production of UCP1 a membrane protein from the inner mitochondrial membrane using the cell free expression system in the presence of a fluorinated surfactant. PMID: 22226924
  15. We observed that stressed rats increased the expression of UCP-1 in the mitochondria and PPAR-gamma. PMID: 20948513
  16. the mammalian thermogenic mitochondrial protein; found in brown adipocytes PMID: 11748291
  17. Superoxide activates mitochondrial uncoupling proteins PMID: 11780125
  18. energy metabolism and expression of uncoupling protein 1 in brown adipose tissue after 21 days of recovery from intracerebroventricular mouse leptin in rats PMID: 12062312
  19. UCP1 muscle gene transfer is associated with an induced mitochondrial proton leak, which could contribute to increase energy expenditure. PMID: 12127082
  20. High levels are expresssed in muscle of transgenic mice and selective affect muscles at rest and decreases their IIb fiber content PMID: 12221093
  21. Data show that rosiglitazone or retinoid treatment activates p38 MAP kinase, which is involved in uncoupling protein-1 (UCP-1) gene expression in fetal rat brown adipocytes. PMID: 12414803
  22. Substitutional mutations in the uncoupling protein-specific sequences of UCP1 revealed amino acid residues of the first alpha-helix UCP signature may be required to hold the intact UCP1 transport conformation PMID: 12479871
  23. Effects of dietary protein content on uncoupling proteins (UCP) 1, 2 and 3 expression in various tissues of Zucker lean and obese rats were studied PMID: 12603007
  24. Model where the nucleotide binds deep inside the bundle core. The purine ring interacts with the matrix loops while the polyphosphate chain is stabilized through interactions with essential Arg residues. PMID: 12678439
  25. Results suggest that ventromedial hypothalamic lesions enhance expression of uncoupling proteins 1, 2, and 3 in brown adipose tissue under long-term fasting through an increase in peroxisome proliferator-activated receptor-gamma activity. PMID: 12706490
  26. study of isolation, refolding, transport properties, and regulation of recombinant UCP1 PMID: 12734183
  27. Independent caudal brainstem Mc3r/Mc4r trigger for sympathetically stimulated elevation in brown adipose tissue UCP-1 gene expression. Melanotan-II induced rise in UCP-1 expression can be mediated by caudal brainstem and spinal cord. PMID: 12960080
  28. UCP1 expression was significantly increased in repeated immobilized group. UCP1 gene expression significantly increased, and acute immobilization induced further increase. PMID: 14529581
  29. results suggest that the inhibition of leptin secretion during lactation is involved in the down-regulation of uncoupling protein 1 and 3 expression in brown adipose tissue and skeletal muscle PMID: 14605003
  30. Alpha-helices are the major component of UCP1 secondary structure. PN-binding mechanism does not involve significant secondary-structure rearrangement. UCP1 shares similar secondary-structure characteristics with the ADP/ATP carrier. PMID: 14766012
  31. Infusion of histamine into the third cerebral ventricle of rats increased the activity of sympathetic nerves and UCP1 mRNA expression in brown adipose tissue. PMID: 15099666
  32. Transgenic mice expressing rat UCP1 show low UCP1 activity under normoxia but is induced during ischemia-reperfusion. The presence of UCP1 mitigates reperfusion-induced damage, probably because it lowers mitochondrial hyperpolarization at reperfusion. PMID: 15262832
  33. has the capacity to regulate metabolic flux and production of reactive oxygen-containing molecules in the thymus. PMID: 15695816
  34. UCP-1, Mc4R and CART gene expression are increased as an immediate consequence of consuming high energy diet, and may be involved in countering hypercaloric intake. PMID: 15720470
  35. The decline in leptin is consistent with the hyperphagic response, and we conclude that one of the mediators of elevated metabolism during prolonged REM-SD is increased gene expression of UCP1 in BAT. PMID: 15727948
  36. Upregulated by rosiglitazone. PMID: 15887043
  37. UCP1 content in rat brown fat is notably affected by changed thyroid status. PMID: 15891081
  38. This result indicates that fucoxanthin upregulates the expression of UCP1 in WAT, which may contribute to reducing WAT weight. PMID: 15896707
  39. the mechanism of action of UCP 1 is to filp long-chain fatty acid anions PMID: 16291746
  40. reactive alkenals activate the proton conductance of UCP1 more strongly when fatty acids are also added, with implications for both mechanistic and physiological models of UCP1 activation PMID: 16451125
  41. Protein chimeras where different regions of the second repeat of UCP1 have been sequentially replaced with their UCP2 counterparts were generated. These chimeras present a progressive degradation of the characteristic bioenergetic properties of UCP1. PMID: 16814247
  42. These data suggested that TUSC5 is involved in the differentiation, and its expression is regulated independently of the beta-adrenergic pathway in BAT. PMID: 17592729
  43. These findings suggest that mitochondrial UCPs could play both a neuro-protective role against oxidative damage and a thermal signaling role for neuro-modulation in vestibular nerve. PMID: 17686539
  44. Benidipine up-regulates not only UCP1 gene expression in BAT but also UCP3 gene expression in BAT and gastrocnemius muscle, which may contribute to thermogenesis in rats. PMID: 17878603
  45. The changes observed in BAT suggest that IL-15 could be implicated in lipid consumption in this tissue by regulating lipid oxidation and probably thermogenesis, processes mediated by UCP1 and UCP3 and PPARdelta and PPARalpha. PMID: 18239634
  46. UCP 1 is present in rat and mouse thymocytes and the antibody to full-length UCP 1 is not specific for UCP 1. PMID: 18471433
  47. UCP1 mRNA expression is upregulated by tea catechins, and the suppressive effect of catechins on body fat is associated with UCP1 expression in brown fat. PMID: 18479902
  48. Data demonstrate that, in pancreatic beta-cells, UCP1/2 have no uncoupling activity in the basal state or after fatty acid stimulation. PMID: 18626658
  49. UCP-2 is the only isoform detectable in the kidney and UCP-2 protein can be detected in proximal tubular cells and cells of the medullary thick ascending loop of Henle PMID: 19227473
  50. demonstrate that activation of UCP1 leads to a purine nucleotide-sensitive decrease in the ubiquinone redox state. PMID: 19747168

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity
Brown adipose tissue.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1