Recombinant Rat Mu-type opioid receptor (Oprm1)

Code CSB-CF016361RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Oprm1; Ror-b; Mu-type opioid receptor; M-OR-1; MOR-1; Opioid receptor B
Species
Rattus norvegicus (Rat)
Expression Region
1-398
Target Protein Sequence
MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for endogenous opioids such as beta-endorphin and endomorphin. Receptor for natural and synthetic opioids including morphine, heroin, DAMGO, fentanyl, etorphine, buprenorphin and methadone. Agonist binding to the receptor induces coupling to an inactive GDP-bound heterotrimeric G-protein complex and subsequent exchange of GDP for GTP in the G-protein alpha subunit leading to dissociation of the G-protein complex with the free GTP-bound G-protein alpha and the G-protein beta-gamma dimer activating downstream cellular effectors. The agonist- and cell type-specific activity is predominantly coupled to pertussis toxin-sensitive G(i) and G(o) G alpha proteins, GNAI1, GNAI2, GNAI3 and GNAO1 isoforms Alpha-1 and Alpha-2, and to a lesser extent to pertussis toxin-insensitive G alpha proteins GNAZ and GNA15. They mediate an array of downstream cellular responses, including inhibition of adenylate cyclase activity and both N-type and L-type calcium channels, activation of inward rectifying potassium channels, mitogen-activated protein kinase (MAPK), phospholipase C (PLC), phosphoinositide/protein kinase (PKC), phosphoinositide 3-kinase (PI3K) and regulation of NF-kappa-B. Also couples to adenylate cyclase stimulatory G alpha proteins. The selective temporal coupling to G-proteins and subsequent signaling can be regulated by RGSZ proteins, such as RGS9, RGS17 and RGS4. Phosphorylation by members of the GPRK subfamily of Ser/Thr protein kinases and association with beta-arrestins is involved in short-term receptor desensitization. Beta-arrestins associate with the GPRK-phosphorylated receptor and uncouple it from the G-protein thus terminating signal transduction. The phosphorylated receptor is internalized through endocytosis via clathrin-coated pits which involves beta-arrestins. The activation of the ERK pathway occurs either in a G-protein-dependent or a beta-arrestin-dependent manner and is regulated by agonist-specific receptor phosphorylation. Acts as a class A G-protein coupled receptor (GPCR) which dissociates from beta-arrestin at or near the plasma membrane and undergoes rapid recycling. Receptor down-regulation pathways are varying with the agonist and occur dependent or independent of G-protein coupling. Endogenous ligands induce rapid desensitization, endocytosis and recycling. Heterooligomerization with other GPCRs can modulate agonist binding, signaling and trafficking properties. Involved in neurogenesis.
Gene References into Functions
  1. Study found that early life repetitive procedures, whether tactile or noxious, do affect the intensity of OPRM1-immunoreactivity in the superficial spinal cord dorsal horn after injury in adulthood, without affecting baseline expression. PMID: 29473323
  2. HDAC2 expression was upregulated during the course of chronic pancreatitis pain induction, while muopioid receptor activity in the thoracic spinal dorsal horn was significantly suppressed. PMID: 29257262
  3. results provide further evidence for the role of accumbens shell mu-opioid receptors but not kappa-opioid receptors in mediating reinforcing e ff ects of EtOH and in regulating EtOH consumption. PMID: 27508965
  4. Oprm1 expression and function are higher in the NAc of sedentary rats selectively bred rats for high voluntary running behavior than rats selectively bred rats for low voluntary running behavior. Findings suggest that inherent differences in Oprm1 action and downstream dopaminergic signaling may influence inherited physical activity behavior. PMID: 27743985
  5. Study demonstrates that in the rat model, endometriosis can be associated with a decrease in mu opioid receptors (MOR)immunoreactivity within neuronal compartments in addition to a shift in MOR and N-methyl-d-aspartate subunit receptor (NR1) receptor expression within the ventral periaqueductal gray. PMID: 27089914
  6. Results suggest that mu opioid receptor-induced suppression of excitatory propagation in the insular cortex is an underlying mechanism of the powerful analgesic effects of mu opioid receptor agonists. In contrast, delta opioid receptors may play a minor role in suppressing acute pain. PMID: 27246300
  7. The findings provide evidence for the existence of MOR on the cell membrane, sarcoplasmatic reticulum and mitochondria in left ventricular cardiomyocytes in rats. However, heart failure does not result in an altered expression of the cardiac MOR-opioid system. PMID: 26686371
  8. Data show that preconception exposure of morphine to female adolescent animals affects their offspring's response to morphine in a sex-specific manner, which may be mediated in part by differential expression of the mu opioid receptor in the nucleus accumbens and ventral tegmental area. PMID: 26700246
  9. findings indicate that G9a contributes critically to transcriptional repression of MORs in primary sensory neurons in neuropathic pain. G9a inhibitors may be used to enhance the opioid analgesic effect in the treatment of chronic neuropathic pain. PMID: 26917724
  10. Results suggested that the high nightly voluntary running distance expressed by female rats selectively bred for running motivation is mediated by increased endogenous mu-opioid receptor signaling in the nucleus accumbens PMID: 26044640
  11. Activation of the mu opioid receptor (MOR) causes GTP to bind to and to activate Go (alphaobetagamma) PMID: 26119705
  12. Smaller cardiovascular responses to stimulation of m1-opioid receptors by endomorphin-2 can be explained by lower expression of M1OR mRNA in the Medial Ncleus sSlitarius of Spontaneously Hypertensive Rats compared to Wistar Kyoto rats. PMID: 25051156
  13. mu-opioid and 5-HT1A receptors cooperatively act to regulate escape behaviour. PMID: 25315826
  14. K303. in the mu opioid (MOP) receptor is important in conferring selectivity for covalent binding of beta-funaltrexamine PMID: 25481857
  15. Study demonstrated that OPRM1 activation attenuated Abeta oligomers-induced neurotoxicity in primary cultured cortical neurons through mTOR signaling PMID: 25146548
  16. The results of this study suggested that upregulation of VTA MOR is necessary for the behavioral and biochemical changes induced by social defeat stress. PMID: 25446676
  17. This study demonistrated that EM2- and SP-containing terminals and GABAergic neurons in the mouse spinal dorsal horn. PMID: 24718557
  18. These results suggest a synergic interaction between the 5-HT1A and the mu-opioid receptor at post-synaptic level on neurons of the dorsal periaqueductal grey that regulate proximal defense, theoretically related to panic attacks. PMID: 23598399
  19. Our data demonstrate that mu-delta heteromer signaling does not desensitize and is regulated differently from mu- and delta-receptor signaling following prolonged morphine treatment. PMID: 24976397
  20. testosterone plays a key role in the regulation of mu-opioid receptor in trigeminal ganglia under inflammatory conditions PMID: 23801566
  21. Fever induced by HIV-glycoprotein 120 is regulated by mu-type opioid receptors. PMID: 24120859
  22. Data indicate 3-methoxythiophen-2-yl)methyl]({2-[(9R)-9-(pyridin-2-yl)-6-oxaspiro-[4.5]decan-9-yl]ethyl})amine (TRV130) as a selective, and G protein biased mu opioid receptor agonist. PMID: 24063433
  23. the association of FKBP12 with OPRM1 attenuates the phosphorylation of the receptor and triggers the recruitment and activation of PKCepsilon. PMID: 24113748
  24. Endomorphin 2 and mu-opioid receptor might be involved in both the homeostatic control and information transmission of micturition. PMID: 23671582
  25. Reduction of mu opioid receptor signaling attenuates cocaine and heroin seeking behavior. PMID: 23299095
  26. The truncated single transmembrane variants can dimerize with the full-length 7-TM mu-opioid receptor (MOR-1) in the endoplasmic reticulum, leading to increased expression of MOR-1 at the protein level. PMID: 23760268
  27. results implicate mu-opiate receptors s in the central nucleus of the amygdala in a positive regulation of sodium intake PMID: 23270855
  28. Activation of both mu and delta opioid receptors relieves both heat-induced and mechanically induced pain. PMID: 23843537
  29. miR-134 participated in inflammatory pain by balancing the expression of MOR1 in dorsal root ganglia PMID: 22865422
  30. Activated mu-opioid receptors are at least partly capable of turning pulmonary C-fiber-mediated, rapid-shallow breathing into an apneic state. PMID: 22796630
  31. A fragment flanking the 5'-end of the GABArho1 gene suffices to drive transcription in the inner nuclear layer of the retina during early postnatal development. PMID: 23106126
  32. In high drinking animals, the anticipation of ethanol is characterized by distinct behaviors, increased exploration and novelty-seeking, and by a specific neurochemical phenotype, greater expression of ENK and MOR within the medial prefrontal cortex. PMID: 22703995
  33. These results suggest that thioredoxin-1 maybe play a role in the actions of morphine. PMID: 22732447
  34. Suggest that opioids acting on mu-receptors in the rostral medullary raphe exert an excitatory modulation of hyperventilation induced by hypoxia. PMID: 21827637
  35. Ghrelin interacts with neuropeptide Y Y1 and opioid receptors to increase food reward PMID: 22210742
  36. A subset of rostral ventromedial medulla neurons expressing mu-opioid receptors contributes to the maintenance of thermal hyperalgesia in neuropathic pain. PMID: 21238509
  37. Mu opioid receptor activation has profound effects on the temporal integration between two primary excitatory pathways in CA1 hippocampal region. PMID: 21056047
  38. chronic ethanol drinking alters the ability of MOR to endocytose in response to opioid peptides, and consequently, promotes tolerance to the effects of opioids PMID: 21602922
  39. MOR was expressed in rat brain neostriatum in both the marginal division as well as in patches, but with different morphological characteristics. These differences in MOR immunoreactivity indicated potential functional differences between them. PMID: 21631922
  40. Activation of mu-opioid receptors in nucleus accumbens shell increased feeding on a sweetened-fat diet. PMID: 20562021
  41. mu-Opioid receptor stimulation in the nucleus accumbens elevates fatty tastant intake by increasing palatability and suppressing satiety signals. PMID: 21543633
  42. The identification of the rat exon 11 and its associated variants further demonstrated conservation of 5' splicing in OPRM1 genes among rodents and humans. PMID: 21255438
  43. Data suggest that multiple reproductive experiences influence both gene activity and kappa, mu, and delta opioid receptor expression in the periaqueductal gray. PMID: 20574683
  44. Glycosylation at the N53 site of the rat mu-opioid receptor does not influence the function of this receptor significantly. PMID: 20592872
  45. These findings demonstrate that delta-opioid receptor activation selectively inhibits inputs activated by icilin, whereas mu-opioid receptor activation has a more widespread effect on synaptic inputs to neurons in the superficial dorsal horn. PMID: 20977770
  46. Spinal cord MOR/KOR heterodimers represent a unique pharmacological target for female-specific pain control. PMID: 21041644
  47. Results suggest that modulation of the delta-opioid receptor 2, but not mu receptor, expression and its synaptic localization may constitute a viable therapeutic approach to disrupt morphine-induced conditioned responses. PMID: 20626460
  48. Data show that mu and kappa opioid receptors are expressed as mRNA and translated into specific receptor proteins on cardiac parasympathetic, sympathetic, and sensory neurons as potential binding sites for opioids. PMID: 20653037
  49. Coexistence of delta-opioid receptors and mu-opioid receptors in small dorsal root ganglia neurons is a basis for direct interaction of opioid receptors in modulation of nociceptive afferent transmission and opioid analgesia. PMID: 20615975
  50. These results suggest that in rat sphenopalatine ganglion neurons activation of M2 mAChR likely modulates mu (micro) opioid receptors transmission in the brain vasculature to adequately maintain cerebral blood flow. PMID: 19889856

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon. Perikaryon. Cell projection, dendrite. Endosome.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Brain. Is expressed in the cerebral cortex, caudate putamen, nucleus accumbens, septal nuclei, thalamus, hippocampus, and habenula. Not detected in cerebellum.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1