Code | CSB-YP016361RA1 |
MSDS | |
Size | Pls inquire |
Source | Yeast |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-EP016361RA1 |
MSDS | |
Size | Pls inquire |
Source | E.coli |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-EP016361RA1-B |
MSDS | |
Size | Pls inquire |
Source | E.coli |
Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-BP016361RA1 |
MSDS | |
Size | Pls inquire |
Source | Baculovirus |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-MP016361RA1 |
MSDS | |
Size | Pls inquire |
Source | Mammalian cell |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
Could you please provide sequence, pricing, availability and tag information for all available sizes?
Can you supply Mu-type opioid receptor (Oprm1) Recombinant Protein with single alanine mutations?
Thank you in advance.
MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMV