Recombinant Rat Muscarinic acetylcholine receptor M2 (Chrm2)

Code CSB-CF005382RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Chrm2; Chrm-2; Muscarinic acetylcholine receptor M2
Species
Rattus norvegicus (Rat)
Expression Region
1-466
Target Protein Sequence
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTENCVQGEEKESSNDSTSVSAVASNMRDDE ITQDENTVSTSLGHSRDDNSKQTCIKIVTKAQKGDVCTPTSTTVELVGSSGQNGDEKQNI VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is adenylate cyclase inhibition. Signaling promotes phospholipase C activity, leading to the release of inositol trisphosphate (IP3); this then triggers calcium ion release into the cytosol.
Gene References into Functions
  1. Data suggest that levels of CHRM2 are lower in Brodmann's area 24 from subjects with mood disorders, and it is possible that signalling by that receptor is also less in this cortical region; increasing levels of CHRM2 may be involved in the mechanisms of action of mood stabilisers and tricyclic antidepressants PMID: 26475745
  2. Long-term stimulation with autoantibodies against M2 muscarinic receptor leaded to the ventricular dilatation and gradual deterioration of cardiac dysfunction. PMID: 26086781
  3. The expression of alpha-SMA mRNA in detrusor muscle cells was 200 times higher than that in urothelial cells in controls. PMID: 25681120
  4. This study demonistrated that brain cholinergic receptors and acetylcholinesterase activity in rats following early life arsenic exposure. PMID: 24517892
  5. Hyperglycemia caused a higher expression of M2-muscarinic receptors in cardiomyocytes. PMID: 22293779
  6. the present study showed the involvement of M2 cholinergic receptors in the complex mechanisms of functional interactions between dopaminergic and cholinergic systems involved in the control of yawning and genital grooming. PMID: 23041487
  7. The extended distribution of M4 receptors in the cortex compared to the weaker and restricted area of distribution of M2 receptors is in favor of a major modulatory role of M4 receptors. PMID: 20600670
  8. The muscarinic M(4) receptor is the functionally predominant subtype in rat striatum. PMID: 21114972
  9. We found a tendency in the gene expression of muscarinic receptor subtypes from M2 toward M3 after birth trauma. PMID: 20445960
  10. Bile acid-induced arrhythmia is mediated by muscarinic M2 receptors in neonatal rat cardi PMID: 20300620
  11. Coexpression of GABA B2 receptors rescues cell surface expression and function of muscarinic M2 receptors at the plasma membrane. PMID: 20016095
  12. The dysfunction of inhibitory neuronal M2 muscarinic receptors in the airways protects against hyperreactivity and in the ileum contributes to gastrointestinal dysmotility associated with streptozotocin-induced diabetes. PMID: 11906948
  13. Vitamin A deficiency promotes bronchial hyperreactivity in rats by altering muscarinic M(2) receptor function. PMID: 11943668
  14. in normal bladders both M(2) and M(3) receptors can induce contraction and in the denervated bladder, the M(2) and the M(3) receptors interact in a facilitatory manner to mediate contraction. PMID: 12185001
  15. The presence of large, cholinergic C-bouton nerve terminals is associated with m2-like immunoreactivity in the postsynaptic membrane. PMID: 12717708
  16. These results show that activation of peripheral M2 receptors produces antinociception in vivo and the inhibition of nociceptor activity in vitro. PMID: 14715385
  17. evidence for the presence of M(2)- and M(3)-mAChR, at the mRNA and protein level, in the rat myometrium and that estrogen induces an increase in myometrial responsiveness to mAChR agonists PMID: 15062561
  18. the decrease of m2R in the somato-dendritic field of the the nucleus basalis magnocellularis. PMID: 15748786
  19. spontaneous contractions in the neonatal rat bladder are enhanced by activation of M2 and M3 receptors PMID: 16709645
  20. M2-like muscarinic receptor couples to a PTX-insensitive G-protein and to an ATP-dependent pathway to enhance IKV. PMID: 16953191
  21. SET protein directly interacts with the third intracellular loop of the M2 muscarinic receptor and co-immunoprecipitates with the intact receptor expressed in cells. PMID: 17065150
  22. In reticular thalamic nucleus, the m2-immunolabeling was preferentially distributed in the distal dendrite region where cholinergic afferent fibers tend to terminate and in the peripheral region of somata. PMID: 17845913
  23. Our results show that only the M(2) subtype is present in the rat atria PMID: 18443764
  24. The muscarinic receptors in the rat gastric mucosal segments were composed of M(1), M(2) and M(3) subtypes PMID: 18938154

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM2 sub-subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1