Recombinant Rat Oxytocin receptor (Oxtr)

Code CSB-CF017316RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Oxtr; Otr; Oxytocin receptor; OT-R
Species
Rattus norvegicus (Rat)
Expression Region
1-388
Target Protein Sequence
MEGTPAANWSVELDLGSGVPPGEEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLGTWLGCLVASAPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA AAEGNDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFFCCSARYLKGSRPGETS VSKKSNSSTFVLSRRSSSQRSCSQPSSA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. oxytocin receptor binding density was higher in the dorsal lateral septum and nucleus accumbens shell in rats that underwent social instability stress. PMID: 28739524
  2. Pharmacological blockade of paraventricular nucleus oxytocin receptors prevented the anxiolytic effect of synthetic neuropeptide S. PMID: 29118105
  3. To investigate confounding effects of long-term antipsychotic medication, study treated rats with clozapine or haloperidol for 12weeks and assessed expression of the oxytocin receptor in cortical and subcortical brain regions; found no differences between antipsychotic-treated rats and controls. PMID: 27132494
  4. Oxytocin receptor binding density was higher in juveniles than in adults in regions associated with reward and socio-spatial memory and higher in adults than in juveniles in key regions of the social decision-making network and in cortical regions. PMID: 27389643
  5. A critical role for endogenous nucleus tractus solitarius OT-R signaling in mediating the intake-inhibitory effects of endogenous gastrointestinal satiation signals and in diet-induced thermogenesis. PMID: 28575174
  6. Results show that extracellular oxytocin release in the central amygdala is similar between males and females and that OTR in the central amygdala plays a causal role in the regulation of social interest toward juvenile conspecifics in males. PMID: 27235738
  7. These findings suggest a sex-specific role of the OTr in the Bed Nucleus Stria Terminalis in the regulation of social recognition. PMID: 26630388
  8. Oxytocin receptor expression was identified in calcitonin gene-related peptide containing trigeminal ganglion neurons. PMID: 26590611
  9. Blood Oxtr DNA methylation may reflect early experience of maternal care in rats. PMID: 26122287
  10. The present work demonstrates that even under identical endocrine circumstances, oxytocin receptor is differentially regulated in adipose tissue of obese rats depending on fat depot localisation PMID: 25565097
  11. This study demonstrated that hypothalamic OTR mRNA expression peaked during the neonatal period and subsequently decreased. PMID: 25637830
  12. first demonstration of the OTR localization in the islets of Langerhans immunohistochemically PMID: 23500836
  13. Repeated exposure to different caregiving environments, particularly maltreatment during the first postnatal week, produces long-term and age-dependent alterations in amygdala Bdnf, OXTr, and NPY gene expression PMID: 25011012
  14. These findings showed that medial nucleus tractus solitarius (mNTS) neurons are a site of action for oxytocin receptor signaling in food intake control. PMID: 25740340
  15. Overexpression of oxytocin receptors in the hypothalamic paraventricular nucleus increases baroreceptor reflex sensitivity and buffers BP variability in conscious rats PMID: 24834854
  16. Cold water intake inhibits colonic motility partially through oxytocin-oxytocin receptor signaling in the myenteric nervous system pathway, which is estrogen dependent. PMID: 25152590
  17. Oxytocin elicits satiety through both central and peripheral oxytocin receptors in male rats. PMID: 24877632
  18. There are robust sex differences in OTR binding densities in multiple forebrain regions of rats and OTR binding densities correlate with social interest in brain region- and sex-specific ways. PMID: 24055336
  19. Copulation stimulated OTR mRNA expression in the medial preoptic area of male rats, irrespective of previous sexual experience. Sexually experienced males had higher levels of OTR protein in the MPOA than sexually naive males and first-time copulators. PMID: 23474276
  20. Evidence for the existence of dopamine d2-oxytocin receptor heteromers in the ventral and dorsal striatum with facilitatory receptor-receptor interactions PMID: 22824810
  21. OTR is expressed predominantly in non-peptidergic C-fiber cell bodies, but not in peptidergic or mechanoreceptor afferents or in skin nociceptive terminals PMID: 23102456
  22. data suggeset that OT receptors modulate blood oxygen level-dependent activation in response to a novel and respulsive odor such as butyric acid PMID: 23219972
  23. activation of cardiac OT receptors by OT released in response to stress may participate in cardioprotection and inhibition of myocardial IR injury. PMID: 22044052
  24. A transient type of oxytocin receptor may be functioning in neuronal development during the neonatal period. PMID: 21820489
  25. OXTR participates in modulation of maternal behavior in rats, while other emotional behaviors are less related to such behavior. PMID: 22178314
  26. Data suggest that oxytocin and its receptors may have function as a cardiovascular hormone. PMID: 22286791
  27. The potentiation of a social hierarchy induced by stress is accompanied by social status- and region-specific changes in the expression of oxytocin receptor mRNA in the medial amygdala 3 h after the social encounter. PMID: 21750583
  28. Data indicate that RWIS activates both oxytocinergic and vasopressinergic neurons in the PVN and SON, which may project to the NTS or DMV mediating the activity of the neurons by OTR and V(1b)R. PMID: 21858088
  29. Demonstrate that cardiac OTRs are involved in the regulation of cardiac function of ovariectomized spontaneously hypertensive rats. PMID: 20671291
  30. Angiotensin IV elevates oxytocin levels in the rat amygdala and produces anxiolytic-like activity through subsequent oxytocin receptor activation. PMID: 20224888
  31. The results obtained in the present study demonstrate that OTR interaction with mGluR1a is required to initiate rapid cell signalling, resulting in a rapid elevation of Ca2+ flux in hypothalamic astrocytes. PMID: 19807846
  32. signaling via the OTR appears to inhibit estrogen-induced cell proliferation, suggesting that signaling by this receptor might help mediate the protective effect of pregnancy on utrerine leiomyomas PMID: 12517588
  33. central actions of oxytocin receptor during late gestation are necessary for the normal timing of systemic release of oxytocin during suckling, normal pup weight gain, and maintenance of maternal body weight. PMID: 12834434
  34. differences in intracerebral release patterns of oxytocin, rather than differences at the level of oxytocin receptors, are critical for the regulation of maternal aggressive behavior PMID: 16033890
  35. Marked hypertension-induced reduction in oxytocin receptor mRNA expression, not altered by training. PMID: 16157794
  36. Data show that cocaine reduces oxytocin receptor binding density in the ventromedial hypothalamus and bed nucleus of the stria terminalis, but not the amygdala, and has no significant effect on oxytocin mRNA production in the paraventricular nucleus. PMID: 16677710
  37. Oxytocin receptors differentially signal via Gq and Gi proteins in pregnant and nonpregnant rat uterine myocytes. PMID: 17170070
  38. both oxytocin neuronal activity and the oxytocin receptor expression on GnRH cells are not influenced by oestrogen PMID: 17504438
  39. Neonatal oxytocin treatment modulates oxytocin receptor in rat myocardium. PMID: 17537544
  40. There are dynamic region-dependent changes in OTR-expressing cells at parturition. This altered OTR distribution pattern in the brain perinatally reflects the crucial role oxytocin plays in orchestrating both birth and maternal behavior. PMID: 17628000
  41. OT release in the ventromedial hypothalamus mediates the effects of vaginal stimulation on the induction of the PRL secretion needed to establish pseudopregnancy PMID: 18006631
  42. Brain oxytocin receptors mediate ejaculation elicited by 7-hydroxy-2-(di-N-propylamino) tetralin (7-OH-DPAT) in anaesthetized rats. PMID: 18469843
  43. Changes in oxytocin receptor, ERalpha and ERbeta mRNA levels during proestrus and estrus following pseudopregnancy are similar to those during the normal estrous cycle PMID: 19057146
  44. study provides evidence that stimulation of the brain oxytocin receptors by endogenous oxytocin plays significant role in inhibition of cardiovascular responses to stress. PMID: 19258669
  45. The oxytocin receptor is expressed on the smooth muscle of the stomach and mediates excitatory effect of oxytocin on gastric motility. PMID: 19309416
  46. oxytocin and its receptors are involved in nociceptive modulation in the central nucleus of amygdala of rats. PMID: 19429063

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1