Recombinant Rat P2Y purinoceptor 6(P2ry6)

Code CSB-CF737185RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q63371
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MERDNGTIQAPGLPPTTCVYREDFKRLLLPPVYSVVLVVGLPLNVCVIAQICASRRTLTR SAVYTLNLALADLLYACSLPLLIYNYARGDHWPFGDLACRLVRFLFYANLHGSILFLTCI SFQRYLGICHPLAPWHKRGGRRAAWVVCGVVWLVVTAQCLPTAVFAATGIQRNRTVCYDL SPPILSTRYLPYGMALTVIGFLLPFTALLACYCRMARRLCRQDGPAGPVAQERRSKAARM AVVVAAVFVISFLPFHITKTAYLAVRSTPGVSCPVLETFAAAYKGTRPFASANSVLDPIL FYFTQQKFRRQPHDLLQKLTAKWQRQRV
Source in vitro E.coli expression system
Gene Names P2ry6
Protein Names Recommended name: P2Y purinoceptor 6 Short name= P2Y6
Expression Region 1-328
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for extracellular UTP > ADP = 2-methylthio-ATP > ADP-beta-S > ATP = ATP-gamma-S. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Functionally coupled to phospholipase C.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Abundantly expressed in various tissues including lung, stomach, intestine, spleen, mesentery, heart, and, most prominently, aorta.
Database Links

KEGG: rno:117264

STRING: 10116.ENSRNOP00000049439

UniGene: Rn.10671

Related Products

P2ry6 Proteins

P2ry6 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.