Research Area
Neuroscience
Alternative Names
Pmp22; Cd25; Pmp-22; Peripheral myelin protein 22; PMP-22; Protein CD25; SR13 myelin protein; Schwann cell membrane glycoprotein; SAG
Species
Rattus norvegicus (Rat)
Expression Region
1-160aa
Target Protein Sequence
MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Datasheet & COA
Please contact us to get it.
