Recombinant Rat Peripheral myelin protein 22(Pmp22)

In Stock
Code CSB-CF018241RA
Size US$3163
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names Pmp22
Uniprot No. P25094
Research Area Neuroscience
Alternative Names Pmp22; Cd25; Pmp-22; Peripheral myelin protein 22; PMP-22; Protein CD25; SR13 myelin protein; Schwann cell membrane glycoprotein; SAG
Species Rattus norvegicus (Rat)
Source in vitro E.coli expression system
Expression Region 1-160aa
Target Protein Sequence MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 23.4 kDa
Protein Length Full Length
Tag Info N-terminal 10xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Might be involved in growth regulation, and in myelinization in the peripheral nervous system.
Gene References into Functions
  1. Enhanced PMP22 protein expression and morphological improvements coincide with the abolishment of thermal and mechanical hypersensitivity and pain alleviation after crush injury of a myelinated peripheral nerve. PMID: 22190549
  2. both functions of PMP22, in regulating Schwann cell differentiation and contributing to peripheral myelin compaction, are affected by its overexpression. PMID: 11456309
  3. Gas3/PMP22 levels can alter membrane traffic of the Arf6 plasma-membrane-endosomal recycling pathway and show that, similarly to other tetraspan proteins, Gas3/PMP22 can accumulate in the late endosomes PMID: 12584243
  4. During early stages of myelination, PMP22 and beta4 integrin are coexpressed at the DRG cell surface and can be coimmunoprecipitated together with laminin and alpha6 integrin. PMID: 16436605
  5. miR-29a represses expression of PMP22; analyses of miR-29 & PMP22 in sciatic nerves reveal inverse relationship, developmentally & in post-crush injury; PMP22 identified as target of miRNAs & suggest miRNAs regulate Schwann cell myelin expression PMID: 19170179

Show More

Hide All

Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families PMP-22/EMP/MP20 family
Tissue Specificity Found exclusively in the peripheral nervous system. Present in both myelinating and nonmyelinating Schwann cells. Found in the tumors of Schwann cell lineage where axons are present (neurofibromas) but not where axons are absent (schwannomas).
Database Links

KEGG: rno:24660

STRING: 10116.ENSRNOP00000051201

UniGene: Rn.1476

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1