Recombinant Rat Peripheral myelin protein 22(Pmp22)

In Stock
Code CSB-CF018241RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P25094
Relevance Might be involved in growth regulation, and in myelinization in the peripheral nervous system.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE
Research Area Neuroscience
Source in vitro E.coli expression system
Gene Names Pmp22
Protein Names Protein CD25 (SR13 myelin protein) (Schwann cell membrane glycoprotein) (SAG) (Cd25) (Pmp-22)
Expression Region 1-160aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 23.4 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Might be involved in growth regulation, and in myelinization in the peripheral nervous system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families PMP-22/EMP/MP20 family
Tissue Specificity Found exclusively in the peripheral nervous system. Present in both myelinating and nonmyelinating Schwann cells. Found in the tumors of Schwann cell lineage where axons are present (neurofibromas) but not where axons are absent (schwannomas).
Database Links

KEGG: rno:24660

STRING: 10116.ENSRNOP00000051201

UniGene: Rn.1476

Related Products

Pmp22 Proteins

Pmp22 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.