Recombinant Rat Phospholemman (Fxyd1)

Code CSB-CF009089RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Fxyd1; Plm; Phospholemman; FXYD domain-containing ion transport regulator 1; Sodium/potassium-transporting ATPase subunit FXYD1
Species
Rattus norvegicus (Rat)
Expression Region
21-92
Target Protein Sequence
EAPQEPDPFTYDYHTLRIGGLTIAGILFILGILIILSKRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na(+) out of the cell and K(+) into the cell. Inhibits NKA activity in its unphosphorylated state and stimulates activity when phosphorylated. Reduces glutathionylation of the NKA beta-1 subunit ATP1B1, thus reversing glutathionylation-mediated inhibition of ATP1B1. Contributes to female sexual development by maintaining the excitability of neurons which secrete gonadotropin-releasing hormone.
Gene References into Functions
  1. Data suggest Ncx1 (sodium-calcium exchanger 1) is substrate-specifying Pp1c (protein phosphatase 1c) regulator protein, regulating Ncx1 activity via Ser-68-Plm dephosphorylation in cardiomyocytes; Plm/Ncx1/Pp1c complex is up-regulated in heart failure. PMID: 26668322
  2. PLM exists as a pump-inhibiting monomer and an unassociated oligomer. PMID: 23532852
  3. Chronic nicotine modifies skeletal muscle Na,K-ATPase activity through its interaction with the nicotinic acetylcholine receptor and phospholemman. PMID: 22442718
  4. role of protein phosphatase-1 on phospholemman phosphorylation and Na/K-ATPase activity in cardiomyocytes PMID: 21849407
  5. palmitoylation of PLM controls its turnover, and palmitoylated PLM inhibits the sodium pump. PMID: 21868384
  6. Report altered expression of Na(+)-K(+) pump subunits, FXYD1 and NHE1 depending on training status, intensity and muscle type. PMID: 21325644
  7. hypertonic activation of this protein in solitary rat hepatocytes in primary culture PMID: 12606048
  8. Expression in the extraglomerular mesangial cells and juxtaglomerular apparatus arterioles PMID: 12657562
  9. Myocardial ischemia-induced phosphorylation of phospholemman directly activates cardiac Na/K-ATPase. PMID: 14597563
  10. PLM phosphorylation at Ser68 may be involved in cAMP- and/or protein kinase C-dependent regulation of cardiac contractility. PMID: 15653756
  11. In skeletal muscle, PLM appears to be a protein integral to the Na+-K+-ATPase(NKA) complex, and PLM has the potential to modulate NKA in an isoform-specific and muscle type-dependent manner in aging and after exercise training. PMID: 15961612
  12. These results suggest that FXYD1 contributes to facilitating the advent of puberty by maintaining GnRH neuronal excitability to incoming transsynaptic stimulatory inputs. PMID: 19187398

Show More

Hide All

Subcellular Location
Cell membrane, sarcolemma; Single-pass type I membrane protein. Apical cell membrane; Single-pass type I membrane protein. Membrane, caveola. Cell membrane, sarcolemma, T-tubule.
Protein Families
FXYD family
Tissue Specificity
In adult brain, highest levels are found in the cerebellum and in the lateral, third and fourth ventricles of the choroid plexus (at protein level). Also detected in cells of a portion of the ependymal lining of the lateral ventricle on its rostral surfac
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1