Recombinant Rat Pituitary adenylate cyclase-activating polypeptide type IA receptor(Adcyap1r1)

Code CSB-CF001347RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Adcyap1r1
Uniprot No. P32215
Alternative Names Adcyap1r1; Pituitary adenylate cyclase-activating polypeptide type I receptor; PACAP type I receptor; PACAP-R-1; PACAP-R1
Species Rattus norvegicus (Rat)
Expression Region 20-523
Target Protein Sequence MHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQVGEMVLVSCPEV FRIFNPDQVWMTETIGDSGFADSNSLEITDMGVVGRNCTEDGWSEPFPHYFDACGFDDYE PESGDQDYYYLSVKALYTVGYSTSLATLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMNDSTALWWVIKGPVVGSIMVN FVLFIGIIIILVQKLQSPDMGGNESSIYLTNLRLRVPKKTREDPLPVPSDQHSPPFLSCV QKCYCKPQRAQQHSCKMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVF ELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFTMDFKHRHPSLASSGVNGGT QLSILSKSSSQLRMSSLPADNLAT
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract.
Gene References into Functions
  1. This study demonstrated that the hypothalamic PAC1 mRNA expression level fell after 24 h fasting in male rats, but no such changes were observed in the females. PMID: 27181029
  2. Compared to the rats in the control group, the rats in the HF group had the expression levels of 12 genes with significant changes, Agrp, Ghrl, and Nr3c1, Apoa4, Cntf, Ghr, IL-1beta, Ins1, Lepr,Sort, Adcyap1r1 and Adrb1. PMID: 22715380
  3. PACAP-38 cause release of CGRP from trigeminal nucleus caudalis but not from trigeminal ganglia but not via activation of PAC1. PMID: 24508136
  4. PAC1-R-immunoreactive structures appearing from postnatal day 5 (P5) to P10 in the rat retina, are described.. PMID: 24352804
  5. Middle meningeal arteries expressed multiple variants of the PAC1 receptor. The expression of PAC1 receptors and the high potency of PACAP to induce MMA vasodilation are consistent with their potential roles in the etiology of migraine. PMID: 22766684
  6. PACAP causes PAC1/VPAC2 receptor mediated hypertension and sympathoexcitation in normal and hypertensive rats. PMID: 22886412
  7. PAC1hop, null and hip receptors mediate differential signaling through cyclic AMP and calcium leading to splice variant-specific gene induction in neural cells. PMID: 21693142
  8. If small molecule PAC-1 receptor antagonists could be identified, they might produce broad-spectrum analgesia in both inflammatory and neuropathic pain states. PMID: 18337184
  9. inhibitory effect of pituitary adenylate cyclase-activating polypeptide on food intake may be mediated, at least in part, through modulation of neuropeptide Y neurotransmission. PMID: 16888209
  10. the hop cassette of the PAC1 receptor has a role in coupling to Ca2+ elevation required for PACAP-evoked neurosecretion. PMID: 17213203
  11. pituitary adenylate-cyclase activating polypeptide and its type 1 receptor, functions as a stimulator of prolactin alone or with thyrotropin releasing hormone in prolactin producing cells PMID: 21539889
  12. Expression of pituitary adenylate cyclase-activating peptide 1 receptor (PAC1) is significantly increased in the brain of aged rats. PMID: 20599818
  13. In HEK cells stably overexpressing functional rat PAC1 receptors, PACAP-27 and PACAP-38 strongly stimulated alpha-secretase cleavage of APP. PMID: 16401644
  14. PAC1-R immunoreactivity was co-localized with afferent dendritic neuronal marker GluR2/3 in nerve fibers passing beneath and lateral to the inner hair cell and in fibers at supranuclear and basal sites on outer hair cells. PMID: 16876955
  15. The specificity of PAC1 receptor participation in pituitary adenylate cyclase-activating polypeptide-facilitated sex behavior was demonstarted.(PAC1 receptor) PMID: 15976009
  16. PAC1HOP1 receptor activation coordinates multiple neurotrophic signaling pathways, which involves Akt activation through phosphatidylinositol 3-kinase gamma and vesicle endocytosis for neuronal survival PMID: 20093365
  17. no age-related differences were observed for pituitary adenylate cyclase activating peptide 1 receptor mRNA in the suprachiasmatic nucleus of young or aged male rats PMID: 15344914
  18. PAC1(3a) was originally discovered in testes as another potential regulator in rat astrocytes PMID: 16888214
  19. PAC1-R-positive cells were also seen in the thymic medulla of the rhesus monkey PMID: 16888229
  20. Novel stable PACAP analogs with potent activity towrds the PAC1 receptor are freported. PMID: 18353507

Show More

Hide All

Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Tissue Specificity Hypothalamus, anterior pituitary, adrenal medulla, testicular germ cells.
Database Links

KEGG: rno:24167

STRING: 10116.ENSRNOP00000016175

UniGene: Rn.234543

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1