Recombinant Rat Podoplanin(Pdpn)

Code CSB-CF017739RA
Product Type Transmembrane Protein
Size $549
Uniprot No. Q64294
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence GAIGALEDDLVTPGPGDDMVNPGLEDRIETTDTTGELDKSTAKAPLVPTQPPIEELPTSGTSDHDHKEHESTTTVKAVTSHSTDKKTTHPNRDNAGGETQTTDKKDGLAVVTLVGIIIGVLLAIGFIGGIIIVVMRKISGRFSP
Source in vitro E.coli expression system
Gene Names Pdpn
Expression Region 23-166
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates effects on cell migration and adhesion through its different partners. During development plays a role in blood and lymphatic vessels separation by binding CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activation and/or aggregation. Interaction with CD9, on the contrary, attenuates platelet aggregation and pulmonary metastasis induced by PDPN. Mediates effects on cell migration and adhesion through its different partners. Through MSN or EZR interaction promotes epithelial-mesenchymal transition (EMT) leading to ERZ phosphorylation and triggering RHOA activation leading to cell migration increase and invasiveness. Interaction with CD44 promotes directional cell migration in epithelial and tumor cells (By similarity). In lymph nodes (LNs), controls fibroblastic reticular cells (FRCs) adhesion to the extracellular matrix (ECM) and contraction of the actomyosin by maintaining ERM proteins (EZR; MSN and RDX) and MYL9 activation through association with unknown transmembrane proteins. Engagement of CLEC1B by PDPN promotes FRCs relaxation by blocking lateral membrane interactions leading to reduction of ERM proteins (EZR; MSN and RDX) and MYL9 activation (By similarity). Through binding with LGALS8 may participate to connection of the lymphatic endothelium to the surrounding extracellular matrix. In keratinocytes, induces changes in cell morphology showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. Controls invadopodia stability and maturation leading to efficient degradation of the extracellular matrix (ECM) in tumor cells through modulation of RHOC activity in order to activate ROCK1/ROCK2 and LIMK1/LIMK2 and inactivation of CFL1 (By similarity). Required for normal lung cell proliferation and alveolus formation at birth (By similarity). Does not function as a water channel or as a regulator of aquaporin-type water channels (By similarity). Does not have any effect on folic acid or amino acid transport (By similarity).
Subcellular Location Membrane, Single-pass type I membrane protein, Cell projection, lamellipodium membrane, Single-pass type I membrane protein, Cell projection, filopodium membrane, Single-pass type I membrane protein, Cell projection, microvillus membrane, Single-pass type I membrane protein, Cell projection, ruffle membrane, Single-pass type I membrane protein, Membrane raft, Apical cell membrane, Basolateral cell membrane, Cell projection, invadopodium
Protein Families Podoplanin family
Tissue Specificity In adult kidney, expressed on the urinary surface and foot processes of podocytes and in parietal epithelial cells of Bowman's capsule where it is localized to luminal surfaces. In lung, expressed exclusively on luminal surfaces of type I alveolar epithel
Database Links

KEGG: rno:54320

STRING: 10116.ENSRNOP00000020316

UniGene: Rn.794

Related Products

Pdpn Proteins

Pdpn Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.