Recombinant Rat Podoplanin (Pdpn)

Code CSB-CF017739RA
Size $1586
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Pdpn
Uniprot No.
Alternative Names
Pdpn; Podoplanin; E11 antigen epitope; RTI140; T1-alpha; T1A; Type I cell 40 kDa protein
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
23-166
Target Protein Sequence
GAIGALEDDLVTPGPGDDMVNPGLEDRIETTDTTGELDKSTAKAPLVPTQPPIEELPTSGTSDHDHKEHESTTTVKAVTSHSTDKKTTHPNRDNAGGETQTTDKKDGLAVVTLVGIIIGVLLAIGFIGGIIIVVMRKISGRFSP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates effects on cell migration and adhesion through its different partners. During development plays a role in blood and lymphatic vessels separation by binding CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activation and/or aggregation. Interaction with CD9, on the contrary, attenuates platelet aggregation and pulmonary metastasis induced by PDPN. Mediates effects on cell migration and adhesion through its different partners. Through MSN or EZR interaction promotes epithelial-mesenchymal transition (EMT) leading to ERZ phosphorylation and triggering RHOA activation leading to cell migration increase and invasiveness. Interaction with CD44 promotes directional cell migration in epithelial and tumor cells. In lymph nodes (LNs), controls fibroblastic reticular cells (FRCs) adhesion to the extracellular matrix (ECM) and contraction of the actomyosin by maintaining ERM proteins (EZR; MSN and RDX) and MYL9 activation through association with unknown transmembrane proteins. Engagement of CLEC1B by PDPN promotes FRCs relaxation by blocking lateral membrane interactions leading to reduction of ERM proteins (EZR; MSN and RDX) and MYL9 activation. Through binding with LGALS8 may participate in connection of the lymphatic endothelium to the surrounding extracellular matrix. In keratinocytes, induces changes in cell morphology showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. Controls invadopodia stability and maturation leading to efficient degradation of the extracellular matrix (ECM) in tumor cells through modulation of RHOC activity in order to activate ROCK1/ROCK2 and LIMK1/LIMK2 and inactivation of CFL1. Required for normal lung cell proliferation and alveolus formation at birth. Does not function as a water channel or as a regulator of aquaporin-type water channels. Does not have any effect on folic acid or amino acid transport.
Gene References into Functions
  1. the binding epitope of PMab-2 remains to be determined. Herein, we investigated the epitope of PMab-2 using enzyme-linked immunosorbent assay, immunohistochemical analysis, and flow cytometry. The results revealed that the critical epitope of PMab-2 is Leu46 and Glu47 of rPDPN. PMID: 30088964
  2. In rats treated with MGO, peritoneal fibrous thickening with the appearance of basophilic spindle cells with podoplanin, cytokeratin, and alpha-smooth muscle actin at the surface of the peritoneum was observed PMID: 26064894
  3. aminopeptidase p and podoplanin are expressed in endothelial cells of blood and lymphatic vessels PMID: 12874451
  4. podoplanin may have a role in tumor progression PMID: 15743802
  5. RTI(40)/MMC4/RTII(70)- and RTI(40)/MMC4-positive cells are intermediates in the ATII-to-ATI cell transformation. PMID: 15849211
  6. Albuminuria in male and female rats is preceded by glomerular hypertrophy and accompanied by focal and segmental loss of podoplanin when focal segmental glomerulosclerosis is not yet present. PMID: 18199599
  7. Decreased expression of podoplanin plays a role in the decrease of glomerular permselectivity. PMID: 18599604
  8. Aggrus is a platelet aggregation-inducing factor expressed in colorectal tumors PMID: 14522983

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein. Cell projection, lamellipodium membrane; Single-pass type I membrane protein. Cell projection, filopodium membrane; Single-pass type I membrane protein. Cell projection, microvillus membrane; Single-pass type I membrane protein. Cell projection, ruffle membrane; Single-pass type I membrane protein. Membrane raft. Apical cell membrane. Basolateral cell membrane. Cell projection, invadopodium.
Protein Families
Podoplanin family
Tissue Specificity
In adult kidney, expressed on the urinary surface and foot processes of podocytes and in parietal epithelial cells of Bowman's capsule where it is localized to luminal surfaces. In lung, expressed exclusively on luminal surfaces of type I alveolar epithel
Database Links

KEGG: rno:54320

STRING: 10116.ENSRNOP00000020316

UniGene: Rn.794

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*