Recombinant Rat Relaxin receptor 1 (Rxfp1)

Code CSB-CF744175RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Rxfp1
Uniprot No.
Alternative Names
Rxfp1; Lgr7; Relaxin receptor 1; Leucine-rich repeat-containing G-protein coupled receptor 7; Relaxin family peptide receptor 1
Species
Rattus norvegicus (Rat)
Expression Region
1-758
Target Protein Sequence
MTSGPFFFCVFIIGRYFTLGNAQDVSCPLGSFPCGNISKCLPQLLHCNGVDDCGNQADED NCGDNNGWSLQLDKYFANYYKLTSTNSIEAETSECLVGSVPMHCLCRDLELDCDEANLRA VPSVSSNVTVMSLQWNFIRTLPPNSFRKYHDLQKLCLQNNKIRSVSVSAFRGLHSLTKLY LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNALTRLPDK PLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINHLNEHAFTHLQKLDEL DLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDYLAKLKSLSLEGIEISNIQQ RMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAITC FGNIFVICMRPYIRSENKLHAMSIMSLCCADCLMGVYLFVIGAFDLKFRGEYRKHAQPWM ESVHCQFMGSLAVLSTEVSVLLLTFLTLEKYICIVYPFRCLRPRKCRTVAVLIFIWITGF IVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGAQIYSVVIFLGINLVAFIIIVFSYG SMFYSVHQSTITATEIQKQVKKEMILAKRFFFIVFTDALCWIPIFILKFLSLIRVEIPDT ITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQLWYNYRQRRSVDRKGTQKAYTPSFIW VEMWPLQEMSTEFMKPDAFTDPCDLSLVSRSSRLNSYS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.
Gene References into Functions
  1. Data indicate that knee passive range of motion (ROM), relaxin receptor isoforms Rxfp1 and Rxfp2 expression were significantly reduced following treatment with testosterone, and androgen antagonist flutamide antagonized the testosterone effect. PMID: 24642882
  2. RXFP1 & RXFP2 up-regulation by progesterone and estrogen could provide the basis for the reported increase in knee laxity while down-regulation of these receptor isoforms by testosterone could explain low incidence of non-contact knee injury in male. PMID: 24465164
  3. RXFP1 was predominantly localized to the tunica media vascular smooth muscle cells in the uterine artery. Highest expression of Rxfp1 in the uterine artery occurred in estrus and early pregnancy. PMID: 22744867
  4. H3 relaxin exerts antifibrotic actions via RXFP1 receptor PMID: 21229994
  5. investigation of expression of RXFP1 in myometrium during gestation; the down-regulation of RXFP1 expression that occurs in late gestation correlates well with progesterone withdrawal PMID: 20686183
  6. investigation of expression of RXFP1 in uterine tissues before, during, and after pregnancy; fetal-placental unit appears involved in regulation of expression of RXFP1; down-regulation of RXFP1 expression occurs in late gestation PMID: 20686184
  7. Uncovered is a pre-assembled, constitutively active G-protein-coupled receptor signalosome, that couples the relaxin receptor, relaxin family peptide receptor 1 (RXFP1), to cAMP following receptor stimulation with sub-picomolar concentrations of peptide. PMID: 20664520
  8. mouse and rat LGR7 are the relaxin receptors in these species PMID: 15566402
  9. Mouse and rat LGR7 were able to bind to and be activated by relaxin ligands PMID: 15956680
  10. LGR7-Truncate is potentially an endogenous regulator of LGR7 signaling PMID: 15956683
  11. both LGR7 and LGR8 are expressed in activated hepatic stellate cells and cirrhotic liver PMID: 15956705
  12. High densities of LGR7 mRNA hybridization were detected in deep layers of neocortex, hypothalamic paraventricular and supraoptic nuclei and within hippocampal subiculum and CA3, the basolateral amygdala and subfornical organ PMID: 15956709
  13. Leucine-rich-repeat-containing G-protein-coupled receptor-7 mRNA was expressed by neurons in several brain regions, including the olfactory bulb, cerebral cortex, thalamus, hippocampus, hypothalamus, midbrain, pons and medulla. PMID: 16725278
  14. derivatives of LGR7 relaxin receptor have a dose dependent affect on the enyzymatic activity of relaxin-sensitive adenylate cyclase PMID: 16776079
  15. Lgr7 and Lgr8 are upregulated in response to a reduction in uteroplacental blood flow in rats. PMID: 17524297
  16. G-protein coupled receptor RXFP1, previously known as LGR7, is widely distributed throughout the male rat reproductive tract and may be important in regulation of spermatogenesis. PMID: 17623071

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in brain cortex, and at low levels in testis.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1