Recombinant Rat Substance-P receptor (Tacr1)

Code CSB-CF023068RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Tacr1; Tac1r; Substance-P receptor; SPR; NK-1 receptor; NK-1R; Tachykinin receptor 1
Species
Rattus norvegicus (Rat)
Expression Region
1-407
Target Protein Sequence
MDNVLPMDSDLFPNISTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAH KRMRTVTNYFLVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASI YSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVC MIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV SAKRKVVKMMIVVVCTFAICWLPFHVFFLLPYINPDLYLKKFIQQVYLASMWLAMSSTMY NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYKVSRLETTIST VVGAHEEEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for the tachykinin neuropeptide substance P. It is probably associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance P > substance K > neuromedin-K.
Gene References into Functions
  1. These data suggest that, through the substance P (SP) receptor, SP could play an important role in regulating postnatal developmental. PMID: 28842244
  2. Neurokinin-1 receptor-expressing neurons in rostro ventromedial medulla appear essential for the development but contribute only partially to the maintenance of chronic post-thoracotomy pain. PMID: 28622274
  3. These results reveal a critical role for endosomal signaling of the NK1R in the complex pathophysiology of pain. PMID: 28566424
  4. Substance P microinjections produced antinociceptive effects only in the Medial Amygdala through NK-1 receptor activation. No USV emissions were detected after the SP microinjections. PMID: 28390968
  5. UVB irradiation induced a significant reduction of the proportion of galanin positive DRG neurons for all time points, except at 12h.UVB irradiation induced increased substance P immunoreactivity in the dorsal part of the spinal cord 48h after irradiation. UVB irradiation also induced c-fos immunoreactivity in the dorsal horn and the area around the central canal 24 and 48h after exposure PMID: 27923581
  6. TRPV1 in the lungs and CRLR and NK1R in the brainstem of rats can be upregulated by lung ischemia-reperfusion injury in a rapid manner. PMID: 27338549
  7. Most medullary dorsal horn neurons providing the collateral axons to the thalamus and parabrachial nucleus were neurokinin-1 receptor positive. PMID: 28097463
  8. We found that prenatal nicotinic exposure failed to change BALF substance P and adenosine content, but significantly upregulated both mRNA and protein TRPV1 and NK1R in the N/J ganglia and only NK1R mRNA in pulmonary C-neurons. PMID: 26524655
  9. Collectively the present results indicated that Pronetupitant acts in vitro as selective NK1 antagonist more potent than Netupitant. PMID: 25843024
  10. The expression of NK1 receptors is upregulated in the dorsal root ganglia and smooth muscle of the corpus cavernosum in rats with thoracic or sacral spinal cord transection. PMID: 24387161
  11. The data of this study support the proposal that an upregulation of the NK1R in the RVM, as well as enhanced release of Sub P following noxious stimulation, underlie the pronociceptive role of Sub P under conditions of persistent inflammatory injury. PMID: 24639151
  12. acute restraint stress activates (internalizes) NK3Rs on surface and evokes nuclear NK3R translocation exclusively in vasopressin neurons PMID: 25281803
  13. cells expressing NK1R in the spinal cord are critical for the development of joint pain, spinal neuroplasticity, and inflammation after trauma to the joint. PMID: 24389017
  14. Substance P activation of the neurokinin-1 receptor induced expression of fetal genes related to pathological hypertrophy in the hypertensive heart. PMID: 23962787
  15. Sustained upregulation of myocardial NK1 receptor, following esmolol treatment, inhibited infarction-induced arrhythmias in rats. PMID: 23994276
  16. NK1R forms physical complexes with NET. PMID: 23979140
  17. This study demonistrated that a de novo expression of NK-1r on pyramidal neurons and an associated increase in substancep-IR innervation of these cells in a model of chronic neuropathic pain PMID: 23172292
  18. Acute colitis induces neurokinin 1 receptor internalization in the rat lumbosacral spinal cord. PMID: 23555638
  19. Demonstrate that atomic force microscopy is a sensitive tool for assessment of functional changes in Chrna7 expressed on the surface of living NK1-R-expressing medullary neurons. PMID: 22962286
  20. These data indicate that NK-1 receptors modulate excitability of ON, OFF and NEUTRAL cells in the rostral ventromedial medulla PMID: 22917610
  21. PAR2 receptors play an acute inflammatory role in the knee joint via TRPV1- and NK1 -dependent mechanisms involving both PAR2 -mediated neuronal sensitization and leukocyte trafficking PMID: 22849826
  22. NK-1 receptor is required for the activation of RBL-2H3 cells following FcepsilonRIota engagement and involved in the regulation of mitogen-activated protein kinase signaling pathways PMID: 22820943
  23. These results indicate the presence of direct innervation by non-peptidergic nociceptive afferents of lamina I projection neurons expressing NK-1r. PMID: 22963197
  24. The NK1 positive neurons projected upon the parabrachial nucleus (PB) within the hindbrain. PMID: 22540287
  25. In acute necrotizing pancreatitis overexpression of NK-1R contributes to disturbance of neuropeptides loop, resulting in aggregation of neutrophilic granulocyte sand promoting deterioration of lung injury. PMID: 12857498
  26. These results suggest that in the early stages of inflammation suppression of the NK1 receptor mechanism in may prevent central sensitization PMID: 22734902
  27. In the ischemic lesion model of adhesiogenesis, TACR1 was differentially expressed between adhesiogenic peritoneum and non-adhesiogenic peritoneum at the time-point of adhesion formation. PMID: 21837425
  28. the role of tachykinin NK receptor in the dorsal horn PMID: 21958872
  29. The data shows that NK(1) receptors play an important role in the early abdominal hyperalgesia in a rat model of sPLA(2)-induced pancreatitis, suggesting that these receptors are of importance in the development of pain in the pancreatitis condition. PMID: 21565534
  30. Stimulation of NK-1 receptor in spinal astrocytes induces calcium release from inositol triphosphate-sensitive intracellular calcium stores, which is positively modulated by protein kinase (PK)A and subsequent calcium influx. PMID: 20933035
  31. Primary afferent synaptic input to neurokinin 1 receptor (NK1R)-expressing neurons is characterized in an inflammatory pain model exhibiting robust mechanical hypersensitivity. PMID: 21451051
  32. Substance P activates both contractile and inflammatory pathways in lymphatics through the neurokinin receptors NK1R and NK3R. PMID: 21166923
  33. LIF and NK-1R were excessively expressed and closely correlated in lungs of the rat asthmatic model. PMID: 16409782
  34. The NK-1R and related neuropeptides are possibly involved in the decrease in voluntary movement of reflux esophagitis. PMID: 20059697
  35. Suggest that glucocorticoid efficacy in arthritis can be improved by blocking substance P and glutamate receptors. PMID: 20128799
  36. Data show that superficial dorsal horn neurons expressing NK-1 receptors play a key role in spinal itch transmission. PMID: 20125052
  37. Post-ischemic blockade of tachykinin 1 receptor inhibits local and remote injuries. PMID: 11815365
  38. Upregulated during nociception PMID: 11876485
  39. substance P may activate, via NK-1 receptors, a hyperplastic but not hypertrophic response in adult cardiac fibroblasts PMID: 11959652
  40. that both PGE2-induced and zymosan-induced mechanical hyperalgesia are mediated in part through activation of NK-1 PMID: 12031786
  41. NK1R internalization and recycling are considerably faster in dorsal horn neurons than in cultured cells; most NK1Rs in dorsal horn neurons are internalized when NK1R-mediated hyperalgesia is more severe. PMID: 12106686
  42. SP metabolites, at times and doses that are antinociceptive, appear to enhance SP-mediated signal transduction by upregulating NK-1 receptor expression without affecting SP synthesis. PMID: 12169105
  43. substance P (NK-1) receptor mechanism in the nucleus tractus solitarius contributes to postexercise hypotension. PMID: 12384463
  44. NK1-positive spinal projection neurons, activated by primary afferent input, project to higher brain areas that control spinal excitability--and therefore pain sensitivity--primarily through descending pathways from the brainstem. PMID: 12402039
  45. neurokinin-1 receptor is localised on the soma-dendritic domain of the inhibitory neurones. PMID: 12421623
  46. Neurons that express SP receptors play a critical role in mediating baroreflexes through the nucleus tractus solitarii PMID: 12468564
  47. Data show that neurokinin-1 receptor (NK-1R) and neurokinin-2 receptor (NK-2R) contribute to intestinal damage, and are involved in pathophysiological changes in acute necrotizing pancreatitis. PMID: 12508374
  48. in neurons in lamina I of the spinal dorsal horn, nk1 receptor-activated signal transduction pathways and activation of T-type voltage-gated calcium channels synergistically facilitate long-term potentiation at synapses from nociceptive nerve fibers PMID: 12595694
  49. Calcitonin gene-related peptide regulates expression of neurokinin1 receptors in rat spinal neurons PMID: 12629185
  50. NK1 receptor immunoreactivity was distributed more extensively throughout the rat stomach than has been described previously. PMID: 12648611

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1