Recombinant Rat Translocator protein (Tspo)

Code CSB-CF025168RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Tspo; Bzrp; Mbr; Translocator protein; Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor; PBR
Species
Rattus norvegicus (Rat)
Expression Region
1-169
Target Protein Sequence
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides.
Gene References into Functions
  1. These results suggest that the imidazole[1,2-a]pyridine-based radiotracer [(18)F]2 is a sensitive tool for noninvasively diagnosing myocarditis related to inflammation of the heart muscle by assessing abnormal TSPO expression. PMID: 29342117
  2. Data suggest that protein (18kDa) (TSPO) may represent a novel therapeutic target for depression in type 2 diabetes mellitus (T2DM). PMID: 27886206
  3. TSPO mutations in rats and a human polymorphism impair the rate of steroid synthesis. PMID: 29074640
  4. Study shows that the neuronal protection mediated by Ro5-4864 in brain injury described in previous studies cannot be solely attributed to an indirect effect of the ligand on glial TSPO but may also represent the consequence of upregulation of TSPO expression in injured neurons. PMID: 27223627
  5. Results suggest that allopregnanolone synthesis is induced by sequential activation o translocator protein 18 kD (TSPO) and 5alpha-reductase in an ex vivo glaucoma model, and that TSPO agonists may serve as potential therapeutic agents for the prevention of pressure-induced retinal damage. PMID: 27596950
  6. Results suggest that in the acute phase after spinal cord injury, the increased expression of 18kDa translocator protein and 5alpha-reductase may represent a protective endogenous response against tissue injury. PMID: 27150077
  7. TSPO mRNA liver levels increased with the severity of liver damage. PMID: 26612465
  8. Estradiol action at the membrane leads to the augmentation of neuroprogesterone synthesis through increasing cAMP, activation of protein kinase A, and the phosphorylation of TSPO and StAR in hypothalamic astrocytes. PMID: 24877623
  9. Data indicate that benzoxazolone derivative showed affinity binding with 18 kDa translocator protein (TSPO). PMID: 24050790
  10. TSPO ligand 4'-chlorodiazepam inhibits oxidative stress and oxysterol formation by reducing the accumulation of cholesterol in the mitochondrial matrix to prevent myocardial ischemia reperfusion injury. PMID: 23554458
  11. Results indicate that although there are reduced amounts of translocator protein (TSPO) in aged Leydig cells. PMID: 23525219
  12. we report that TSPO was upregulated in astrocytes and microglia in the ipsilateral spinal dorsal horn of rats following L5 spinal nerve ligation PMID: 23345228
  13. Data indicate that Increase of TSPO expression was mainly found in the neutrophils and macrophages of inflamed lungs. PMID: 22984611
  14. There is a difference between immature and adult brain in an appearance of withdrawal symptom after administration of the partial agonist of benzodiazepine receptors Ro 19-8022. PMID: 22816377
  15. TSPO strong expression in dividing spermatogonia suggests that it might play a role in spermatogonial mitosis. PMID: 22348614
  16. Data suggest that species-specificity of norbormide toward the rat translocator protein, TSPO, depends on subtle differences in the structure of TSPO or of TSPO-associated proteins affecting its substrate specificity. PMID: 21889488
  17. we have demonstrated that after a stressful stimulus we could observe a general modification of the adipose tissue morphology and an increased expression of PPAR-gamma and TSPO 18-kDa. PMID: 20948513
  18. Novel androstenetriol interacts with the mitochondrial translocator protein and controls steroidogenesis. PMID: 21209087
  19. Clinical consequences of secondary neuronal degeneration in stroke might be better treated thanks to the discrimination of neuronal processes using in vivo molecular imaging and potent TSPO radioligands like CLINDE to guide therapeutic interventions. PMID: 20814674
  20. the permeability transition is an inner membrane mitochondrial event that is regulated by the outer membrane through specific interactions with TSPO PMID: 21062740
  21. DMBA induced oxidative stress in the liver correlating with decreases in TSPO binding capacity in the livers. PMID: 21037200
  22. PBR antagonist may be a potential therapeutic agent for the control of aggressiveness of breast cancer. PMID: 20204676
  23. Peripheral-type benzodiazepine receptor (PBR) protein was increased at 6 and 7 days of age in pups exposed to hypoxia from birth. PMID: 12388447
  24. Mucous and parietal cells of the gastric mucosa express mitochondrial peripheral-type benzodiazepine receptor functionally coupled to Ca(2+)-dependent Cl(-) secretion, possibly involved in the gastric mucosa protection. PMID: 14726306
  25. ACTH has significant, but reversible, effects on the development of adrenocortical function, possibly mediated in part by increased expression of peripheral benzodiazepine receptor PMID: 14962996
  26. Enhanced expression of peripheral benzodiapine receptor provides a mechanism to increase apoptotic rates of cancer cells. PMID: 16026165
  27. Involved in early regenerative response of small caliber sensory axons, the preconditioning effect, and shows that PBR agonists enhance sensory axon regeneration. PMID: 16099172
  28. Reaction of neuronal nitrate synthase over the time of changes in Leydig cell steroidogenic acute regulatory protein and the peripheral-type benzodiazepine receptor. PMID: 16239298
  29. This study provides evidence for PBR involvement in PTP opening, controlling the Ca2+-induced Ca2+ efflux, and AIF release from mitochondria, important stages of initiation of programmed cell death. PMID: 17174393
  30. The present findings collectively support the utility of PBR in identifying a unique temporal pattern of astrocytic and microglial activation that conventional glial markers hardly pursue. PMID: 17540348
  31. These results indicate that DAA1106 binds with higher affinity to microglia in rat models of neuroinflammation when compared with PK11195. PMID: 17555551
  32. These findings identify TSPO as a potential target for controlling neural inflammation, showing that the TSPO ligand PK11195 may reduce microglia activation by a mechanism that is independent of the regulation of neuronal survival. PMID: 17674368
  33. Imortant role of 18-kDa translocator protein in the mechanism of ammonia neurotoxicity. PMID: 17893919
  34. Thus, [(11)C]AC-5216 is a promising PET ligand for imaging PBR in a brain with neuroinflammation. PMID: 17959307
  35. TSPO potentiates proliferation, motility and transmigration capabilities as well as the ability to overcome contact-induced cell growth inhibition of glioma cells. PMID: 18190798
  36. High-affinity ligand binding to mitochondrial Bzrp modulates neurotransmitter-induced salivary secretion by duct and mucous acinar cells of rat submandibular glands. PMID: 18269350
  37. These results suggest that [(11)C]PK-11195 PET imaging would be a useful tool for evaluating microglial activation in a rat brain injury model. PMID: 18600420
  38. PET tracers [11C]-DPA-713 and [18F]-DPA were evaluated for TSPO in a rat model of herpes encephalitis. PMID: 19330384
  39. In rat intestine, TSPO found in mitochondria of enterocytes but not goblet cells. Affinity of TSPO for various ligands varied in duodenum, jejunum, ileum, myocardium, adrenals, and submandibular glands. TSPO exhibited highest affinity for PK 11195. PMID: 19392661
  40. PBR binding to its ligands induced pore and phosphorylation of 3.5-kDa polypeptide in rat brain mitochondria. PMID: 19463096
  41. Ovariectomy causes a significant decrease in uterine, but not renal TSPO binding density, while estradiol treatment of ovariectomized rats restored TSPO binding density in the uterus. PMID: 19524125
  42. spinal TSPO is involved in the development and maintenance of inflammatory pain behaviors in rats PMID: 19555675

Show More

Hide All

Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.
Protein Families
TspO/BZRP family
Tissue Specificity
Highly expressed in adrenal gland.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1