Recombinant Rat Vasoactive intestinal polypeptide receptor 2(Vipr2)

Code CSB-CF025860RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P35000
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence ECRFHLEIQEEETKCAELLSSQMENHRACSGVWDNITCWRPADIGETVTVPCPKVFSNFY SRPGNISKNCTSDGWSETFPDFIDACGYNDPEDESKITFYILVKAIYTLGYSVSLMSLTT GSIIICLFRKLHCTRNYIHLNLFLSFMLRAISVLVKDSVLYSSSGTLRCHDQPGSWVGCK LSLVFFQYCIMANFYWLLVEGLYLHTLLVAILPPSRCFLAYLLIGWGIPSVCIGAWIATR LSLEDTGCWDTNDHSIPWWVIRMPILISIVVNFALFISIVRILLQKLTSPDVGGNDQSQY KRLAKSTLLLIPLFGVHYMVFAAFPIGISSTYQILFELCVGSFQGLVVAVLYCFLNSEVQ CELKRRWRGLCLTQPGSRDYRLHSWSMSRNGSESALQIHRGSRTQSFLQSETSVI
Source in vitro E.coli expression system
Gene Names Vipr2
Protein Names Recommended name: Vasoactive intestinal polypeptide receptor 2 Short name= VIP-R-2 Alternative name(s): Pituitary adenylate cyclase-activating polypeptide type III receptor Short name= PACAP type III receptor Short name= PACAP
Expression Region 23-437
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is a receptor for VIP as well as PACAP-38 and -27, the activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Can be coupled to phospholipase C.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Database Links

KEGG: rno:29555

STRING: 10116.ENSRNOP00000005876

UniGene: Rn.10011

Pathway cAMP signaling pathway

Related Products

Vipr2 Proteins

Vipr2 Proteins for Rattus norvegicus (Rat)

Vipr2 ELISA Kit

Vipr2 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.