Recombinant Rat cGMP-gated cation channel alpha-1(Cnga1)

Code CSB-CF720326RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Cnga1
Uniprot No. Q62927
Alternative Names Cnga1; Cncg; Cncg1; cGMP-gated cation channel alpha-1; Cyclic nucleotide-gated cation channel 1; Cyclic nucleotide-gated channel alpha-1; CNG channel alpha-1; CNG-1; CNG1; Cyclic nucleotide-gated channel, photoreceptor; Rod photoreceptor cGMP-gated channel subunit alpha
Species Rattus norvegicus (Rat)
Expression Region 1-683
Target Protein Sequence MKTNIINTWHSFVNIPNVVVPAIEKEIRRMENGACSSFSDNDNGSLSEESENEDSLFRSN SYRRRGPSQREHYLPGTMALFNVNNSSNKDQDPKEKKKKKKEKKSKADDKKESKKDPEKK KKKEKEKEKKKEEKPKEKKEEEKKEVVVIDPSGNMYYNWLFCITLPVMYNWTMIIARACF DELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDELKLIEKYKANLQFKLD VLSVIPTDLLYFKFGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVI IIHWNACVYYSISKAIGFGNDTWVYPDVNDPEFGRLARKYVYSLYWSTLTLTTIGETPPP VLDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKD MEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLV ELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISI LNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLL DINIANLGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFLKPL IETEFSALEEPGGESEPTESLQG
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Subunit of the rod cyclic GMP-gated cation channel, which is involved in the final stage of the phototransduction pathway. When light hits rod photoreceptors, cGMP concentrations decrease causing rapid closure of CNGA1/CNGB1 channels and, therefore, hyperpolarization of the membrane potential.
Gene References into Functions
  1. Histamine depolarizes projection neurons but not interneurons in the cerebellar nuclei via the hyperpolarization-activated cyclic nucleotide-gated (HCN) channels coupled to histamine H2 receptors. PMID: 25633097
  2. Insulin receptor (IR), an integral membrane protein, directly phosphorylates the CNGA1 subunit of CNG channels that in turn affects the function of these channels negatively. CNGA1 is a direct substrate of IR. PMID: 23032687
  3. estrogen and progesterone act in renal tissues modulating CNG-A1 and Na/K ATPase gene expression PMID: 22759964
  4. Data demonstrate that CNGA1 is expressed in rat cerebellar granule cells and forms functional channels. PMID: 21809342
  5. Data show robust CNGA1 (but not CNGA2 or CNGA3) channel expression principally in rat alveolar type I cells and suggest that CNGA1 channels mediate cGMP-stimulated, amiloride-insensitive, lung liquid absorption. PMID: 21559843
  6. Transcripts for a functional CNG ion channel exist in the cochlea resulting from combinations of CNG2 with CNG5 and CNG4.3. CNG2 and CNG5 immunoreactivity in hair cell stereocilia suggests a role for cAMP-sensitive CNG channels in signal transduction. PMID: 11834291
  7. NO activates the olfactory cyclic nucleotide-gated conductance independent from cGMP in isolated rat olfactory receptor neurons. PMID: 12865170
  8. CNG channels switch on and off the olfactory signaling pathway, and that the on and off signals may both be amplified by the subsequent olfactory signaling steps. PMID: 16940558
  9. Our data imply that HCN-expressing GABAergic neurons provide rhythmic drive in all phases of the hippocampal theta activity. PMID: 18565991
  10. suggest a potential role for HCN channels in regulation of glucagon secretion via modulating Ca(2+) and Na(+) channel activities PMID: 18850083

Show More

Hide All

Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGA1 subfamily
Tissue Specificity Rod cells in the retina.
Database Links

KEGG: rno:85259

STRING: 10116.ENSRNOP00000006469

UniGene: Rn.54534

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1