Recombinant Saccharomyces cerevisiae Accumulation of dyads protein 2 (ADY2)

Code CSB-CF333089SVG
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ADY2
Uniprot No.
Alternative Names
ADY2; ATO1; YCR010C; YCR10C; Accumulation of dyads protein 2; Ammonia transport outward protein 1
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region
1-283
Target Protein Sequence
MSDKEQTSGNTDLENAPAGYYSSHDNDVNGVAEDERPSHDSLGKIYTGGDNNEYIYIGRQ KFLKSDLYQAFGGTLNPGLAPAPVHKFANPAPLGLSAFALTTFVLSMFNARAQGITVPNV VVGCAMFYGGLVQLIAGIWEIALENTFGGTALCSYGGFWLSFAAIYIPWFGILEAYEDNE SDLNNALGFYLLGWAIFTFGLTVCTMKSTVMFFLLFFLLALTFLLLSIGHFANRLGVTRA GGVLGVVVAFIAWYNAYAGVATKQNSYVLARPFPLPSTERVIF
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transporter protein required for ammonia export and acetate uptake and resistance. Necessary for up-regulation and down-regulation of meiotic plaque (MP) component levels in a dependency on external acetate. Has a role in ascus formation.
Gene References into Functions
  1. deletion of SNF1 abolishes the increase of histone H3 acetylation at the promoter of the glucose-repressed ADY2 gene, and as a consequence profoundly affects the chromatin structural alterations accompanying transcriptional activation PMID: 22306658
  2. there is an interaction between molecules of the same Ato protein, namely Ato1p-Ato1p and Ato3p-Ato3p, but not Ato2p-Ato2p PMID: 22579979
  3. study demonstrated that monocarboxylate transporters Jen1 and Ady2 are modulators of lactic acid production PMID: 22260735
  4. The authors show that neighbouring microcolonies coordinate production of Ato1p-green fluorescent protein. PMID: 19302539
  5. These data suggest that besides the ammonia induction of Ato protein synthesis, pH may rapidly regulate Ato1p function. PMID: 17395151

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein. Note=Localizes to large detergent resistant patches of the cell membrane (DRM) enriched in ergosterol and sphingolipids (PubMed:17395151).
Protein Families
Acetate uptake transporter (AceTr) (TC 2.A.96) family
Database Links

KEGG: sce:YCR010C

STRING: 4932.YCR010C

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1