Recombinant Saccharomyces cerevisiae Dynamin-like GTPase MGM1, mitochondrial (MGM1)

Code CSB-CF330150SVG
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MGM1
Uniprot No.
Alternative Names
MGM1; MDM17; YOR211C; YOR50-1; Dynamin-like GTPase MGM1, mitochondrial; Mitochondrial division and morphology protein 17; Mitochondrial genome maintenance protein 1
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region
140-881
Target Protein Sequence
ATLIAATSLDDDESKRQGDPKDDDDEDDDDEDDENDSVDTTQDEMLNLTKQMIEIRTILN KVDSSSAHLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSN NVTADFPSMRLYNIKDFKEVKRMLMELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLP GYIQVEAADQPIELKTKIRDLCEKYLTAPNIILAISAADVDLANSSALKASKAADPKGLR TIGVITKLDLVDPEKARSILNNKKYPLSMGYVGVITKTPSSINRKHLGLFGEAPSSSLSG IFSKGQHGQSSGEENTNGLKQIVSHQFEKAYFKENKKYFTNCQVSTKKLREKLIKILEIS MSNALEPTSTLIQQELDDTSYLFKVEFNDRHLTPKSYLLNNIDVLKLGIKEFQEKFHRNE LKSILRAELDQKVLDVLATRYWKDDNLQDLSSSKLESDTDMLYWHKKLELASSGLTKMGI GRLSTMLTTNAILKELDNILESTQLKNHELIKDLVSNTAINVLNSKYYSTADQVENCIKP FKYEIDLEERDWSLARQHSINLIKEELRQCNSRYQAIKNAVGSKKLANVMGYLENESNLQ KETLGMSKLLLERGSEAIFLDKRCKVLSFRLKMLKNKCHSTIEKDRCPEVFLSAVSDKLT STAVLFLNVELLSDFFYNFPIELDRRLTLLGDEQVEMFAKEDPKISRHIELQKRKELLEL ALEKIDSILVFKKSYKGVSKNL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dynamin-related GTPase required for mitochondrial fusion. Coordinates interaction between the inner and outer mitochondrial membrane to promote the formation of the double membrane.
Gene References into Functions
  1. Mgm1 membrane interactions impose a mechanical force on the membrane to overcome the hydrophilic repulsion of the phospholipid head groups and initiate the fusion reaction. PMID: 25784211
  2. Psd1 promotes mitochondrial fusion by regulating the biophysical properties of the mitochondrial membrane and alternative topogenesis of Mgm1. PMID: 23045528
  3. Mechanistic details of the two known in vivo functions of Mgm1, membrane fusion and cristae maintenance. PMID: 22977249
  4. Absence of mitochondrial fusion in the Deltamgm1 mutant leads to a striking reduction of both replicative and chronological lifespan. PMID: 21912203
  5. Data show that charged residues in the regions flanking the first segment in Mgm1p critically affect the ratio between the two isoforms, providing new insight of charged residues in the insertion of proteins into the mitochondrial inner membrane. PMID: 21457713
  6. Trans Mgm1 interactions on opposing inner membranes function similarly to tether and fuse inner membranes as well as maintain crista structures and propose a model for how the mitochondrial dynamins function to facilitate fusion. PMID: 17055438
  7. Mgm1 promotes the fusion of opposing mitochondrial inner membranes PMID: 19703904
  8. Coassembly of Mgm1 isoforms requires cardiolipin and mediates mitochondrial inner membrane fusion. PMID: 19752025

Show More

Hide All

Subcellular Location
[Dynamin-like GTPase MGM1 large isoform]: Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side. Mitochondrion intermembrane space.; [Dynamin-like GTPase MGM1 small isoform]: Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.
Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Database Links

KEGG: sce:YOR211C

STRING: 4932.YOR211C

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1