Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM22 (TIM22)

Code CSB-CF615492SVG
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
TIM22
Uniprot No.
Alternative Names
TIM22; YDL217C; D0884; Mitochondrial import inner membrane translocase subunit TIM22
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region
1-207
Target Protein Sequence
MVYTGFGLEQISPAQKKPYNELTPEEQGERGAEMIMNFMTSCPGKSVVSGVTGFALGGVL GLFMASMAYDTPLHTPTPANTAATATAGNIGVGGISRTVQQISDLPFRQQMKLQFTDMGK KSYSSAKNFGYIGMIYAGVECVIESLRAKNDIYNGVTAGFFTGAGLAYKAGPQAALMGGA GFAAFSAAIDLYMKSEDGRPPQNDFKE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins, such as mitochondrial carrier family members, into the mitochondrial inner membrane. In the TIM22 complex, it constitutes the voltage-activated and signal-gated channel. Forms a twin-pore translocase that uses the membrane potential as external driving force in 2 voltage-dependent steps. Mediates the insertion of precursor proteins in a 3 step process. After the precursor is tethered to the translocase without losing energy from the Delta(psi), 2 energy-requiring steps are needed. First, Delta(psi) acts on the precursor protein and promotes its docking in the translocase complex. Then, Delta(psi) and an internal signal peptide together induce rapid gating transitions in one pore and closing of the other pore and drive membrane insertion to completion.
Gene References into Functions
  1. reduced phosphatidylcholine levels differentially affect the TIM22 and TIM23 complexes in mitochondrial protein transport. PMID: 27402832
  2. We propose that Mia40 not only is responsible for disulfide bond formation, but also assists the Tim22 protein in its integration into the inner membrane of mitochondria. PMID: 23283984
  3. When Hot13p is overexpressed, it may function to remodel the small TIM complexes during import. PMID: 15294910
  4. the carboxyl-terminal module of dicarboxylate carrier possesses major targeting information to facilitate the direct binding of the carrier protein to TIM22 PMID: 15591051
  5. Phosphate carrier (PiC) can be sorted to either the TIM22 pathway or the TIM23 pathway for its import into yeast mitochondria PMID: 15644337
  6. The Tim21 structure represents a new alpha/beta-mixed protein fold with two alpha-helices flanked by an extended eight-stranded beta-sheet. Here we suggest a mechanism for the TOM-TIM interaction. PMID: 17099692
  7. TIM22 as a dynamic channel solely active in the presence of its cargo proteins PMID: 17462993

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Note=Import into inner membrane protein requires TOM20 function.
Protein Families
Tim17/Tim22/Tim23 family
Database Links

KEGG: sce:YDL217C

STRING: 4932.YDL217C

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1