Recombinant Saccharomyces cerevisiae Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

Code CSB-CF005319SVG
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MIA40
Uniprot No.
Alternative Names
MIA40; TIM40; YKL195W; Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region
32-403
Target Protein Sequence
MASSPQFGRNSNQEKTAGFIMGILSMAGALYFIAPNRKPLFASRKVESDKTAEEELSSGG EQSPENEDDNNSKSDENGDDNDSKNDETEAGPQLGGDKIGASKVAEDGELVVLAEEDNKS SEDKDTDESKVSTKDDEQSNEDNATANNQKDENISSENSEENTSDKTLDNNAGSSEKKDP EHSDDEKSQQGQSDDKTTTEDNNGEEESSKKTVSDSENSAKQSESSDEEKEELRKQEEKQ MGPTEEEVQHEGAYNPDTGEINWDCPCLGGMAHGPCGEEFKSAFSCFVYSEAEPKGIDCV EKFQHMQDCFRKYPEHYAEQLKETSDDEEPQDKVKVNTIESAPNVSSAKENAAKKAEQSD VKKEPLNEESKP
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Forms a redox cycle with ERV1 that involves a disulfide relay system. Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS. Reduced MIA40 is reoxidized by FAD-linked sulfhydryl oxidase ERV1.
Gene References into Functions
  1. the question whether parasite Erv homologs might also exert the function of Mia40 was addressed in another set of complementation assays. However, neither the KISS domain nor other truncated or mutant LtErv constructs were able to rescue yeast cells that lack ScMia40 PMID: 29310075
  2. Plant Erv1, unlike its homologs in fungi and animals, can promote protein import and oxidative protein folding in the IMS independently of the oxidoreductase Mia40. PMID: 29117860
  3. The authors show that the substrate-binding domain of Mia40 is both necessary and sufficient to promote protein import, indicating that trapping by Mia40 drives protein translocation. PMID: 27343349
  4. Mia40 catalyses the oxidative folding of disulphide-containing proteins in the mitochondria. PMID: 24407114
  5. Mia40 role in mitochondrial oxidative protein folding and import PMID: 24983157
  6. Data indicate that in addition to its thiol oxidase function, Mia40 is active as a disulfide reductase and isomerase. PMID: 25451030
  7. Mia40 oxidizes Mrp10 during import into mitochondria. PMID: 24360785
  8. Saccharomyces cerevisiae Mia40 is a mitochondrial iron-sulfur protein. PMID: 23834247
  9. Atp23 was identified as a novel substrate of Mia40. Oxidation of Atp23 is not essential for its import; an Atp23 variant in which all ten cysteine residues were replaced by serine residues still accumulates in mitochondria in a Mia40-dependent manner. PMID: 22990235
  10. Glutathione redox potential in the mitochondrial intermembrane space is linked to the cytosol and impacts the Mia40 redox state. PMID: 22705944
  11. The oxidoreductase of the mitochondrial disulfide relay, Mia40, controls oxidative folding of domain I of the copper chaperone Ccs1 whereby controlling the cellular distribution of Ccs1 and, consequently, active Superoxide dismutase 1 (Sod1). PMID: 21865594
  12. The 9-aa internal peptide making up the mitochondrial intermembrane space -targeting signal (ITS) involved in docking with Mia40 is characterized. PMID: 20026652
  13. Mia40 is the first essential component of a specific translocation pathway of metal-binding intermembrane space proteins. PMID: 15620710
  14. Mia40 acts as a trans receptor in the biogenesis of the Tim9-Tim10 chaperone complex of mitochondria PMID: 17553782
  15. Results show that oxidative folding of Tims 9 and 10 is mediated by site-specific docking onto Mia40 in the mitochondrial intermembrane space. PMID: 17680986
  16. analysis of how mitochondrial biogenesis switches the sorting pathway of the intermembrane space receptor Mia40 PMID: 18779329
  17. Study shows that Hot13, a conserved zinc-binding protein, interacts functionally and physically with the import receptor Mia40; it improves the Erv1-dependent oxidation of Mia40 both in vivo and in vitro. PMID: 18787558
  18. the cysteine residues have distinct roles and are not equally important for Mia40 function. PMID: 19011240
  19. Results are consistent with the growth phenotypes of Mia40 mutant cells containing Ser replacement of the conserved cysteine residues. PMID: 19667201

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side.
Database Links

KEGG: sce:YKL195W

STRING: 4932.YKL195W

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1