Recombinant Saccharomyces cerevisiae Pheromone alpha factor receptor (STE2)

Code CSB-CF517141SVG
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
STE2
Uniprot No.
Alternative Names
STE2; YFL026W; Pheromone alpha factor receptor
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region
1-431
Target Protein Sequence
MSDAAPSLSNLFYDPTYNPGQSTINYTSIYGNGSTITFDELQGLVNSTVTQAIMFGVRCG AAALTLIVMWMTSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVTYALTGFPQFI SRGDVHVYGATNIIQVLLVASIETSLVFQIKVIFTGDNFKRIGLMLTSISFTLGIATVTM YFVSAVKGMIVTYNDVSATQDKYFNASTILLASSINFMSFVLVVKLILAIRSRRFLGLKQ FDSFHILLIMSCQSLLVPSIIFILAYSLKPNQGTDVLTTVATLLAVLSLPLSSMWATAAN NASKTNTITSDFTTSTDRFYPGTLSSFQTDSINNDAKSSLRSRLYDLYPRRKETTSDKHS ERTFVSETADDIEKNQFYQLPTPTSSKNTRIGPFADASYKEGEVEPVDMYTPDTAADEEA RKFWTEDNNNL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the peptide pheromone alpha factor, the mating factor of yeast.
Gene References into Functions
  1. Interaction between Ste2p and Gpa1p takes palce before ligand binding via the Ste2p C-terminal domain and the Gpa1p N-terminal domain. PMID: 28958779
  2. yeast pheromone receptor Ste2 forms predominantly tetramers at average expression levels of 2 to 25 molecules per pixel and a mixture of tetramers and octamers at expression levels of 25-100 molecules per pixel. Ste2 is a class D GPCR found in the yeast Saccharomyces cerevisiae of the mating type a, and binds the pheromone a-factor secreted secreted by cells of the mating type a PMID: 27993568
  3. The main difference between the Ste2 and Ste3 receptor observed in this work was that while hyperactive mutations were found for Ste3, no gain-of-function mutant for the Ste2 receptor was found. this fi nding is an outcome of the different strategies the two genes have adopted for their expression. PMID: 27150158
  4. Results suggest that the G-protein-coupled receptor, Ste2 binds the inhibitory G-protein signaling, Sst2 forming a complex with antagonistic functions. PMID: 28034910
  5. Variable Dependence of Signaling Output on Agonist Occupancy of Ste2p, a G Protein-coupled Receptor in Yeast PMID: 27646004
  6. results extend previous observations and quantify the contributions of Ste2p variants to mediating cell cycle arrest versus downstream mating functionalities. PMID: 26232403
  7. we propose that the N-terminus of Ste2p plays multiple regulatory roles in controlling receptor function. PMID: 26707753
  8. A strategy for the identification of stabilized variants of the yeast alpha-factor receptor Ste2p. PMID: 25647246
  9. Results show that Ste2 is downregulated by endocytosis, both constitutive and ligand induced and its internalization requires its phosphorylation and ubiquitinylation through the action of alpha arrestins. PMID: 24820415
  10. C-terminally trancated forms of Ste2p exert dominant-negative effects. PMID: 22923047
  11. structure determination of transmembrane segments of Y4 and the yeast Ste2p G-protein-coupled receptors PMID: 22947943
  12. the identification of disulfide bonds that stabilize the active state of the yeast alpha-mating pheromone receptor Ste2p PMID: 22387470
  13. C-terminus contains multiple functional domains with differential and interdependent roles in regulating Ste2p function. PMID: 22100461
  14. a cryptic polyadenylation site is present inside the coding region of the a-specific STE2 gene, encoding the receptor for the alpha-factor PMID: 21969566
  15. study provides new information about role of specific residues of STE2, a GPCR, in signal transduction and how peptide ligand binding activates the receptor PMID: 21728340
  16. These results suggest that receptor--agonist interactions, such as those involving Ste2p, involve at least two sites, of which only one is specific for the activated conformation of the receptor. PMID: 21477594
  17. Kinetic analysis suggests that alpha-factor associates with its receptor STE2 via a two-stage process consisting of an initial binding event followed by a rearrangement of the ligand-receptor complex. PMID: 15491163
  18. Thirty-five different STE2 suppressor mutations were identified by isolating second-site suppressor mutations that restored function to defective receptors carrying either an F204S or Y266C substitution. PMID: 15667221
  19. NMR analysis; findings suggest helical subdomains existed in both the transmembrane and cytosolic tail; as the tail participates in down-regulation of Ste2p, helical regions in the tail may play a role in protein-protein interactions in endocytosis PMID: 16128581
  20. there is an interaction between specific residues in an active state, but not the resting state, of Ste2p PMID: 16314417
  21. that G protein signaling and homologous desensitization are independent cellular processes PMID: 16325780
  22. TEDS site phosphorylation of the yeast myosins I is required for ligand-induced but not for constitutive endocytosis of Ste2p PMID: 16478726
  23. signal transduction by oligomeric Ste2p receptors appears to be a cooperative process requiring an interaction between functional monomers PMID: 16709573
  24. Amiono acid residues of Ste2 that are accessible to the cytoplasmic G-protein are defined and provide an important structural framework for the interpretation of the role of Ste2 residues that function in G-protein activation. PMID: 17176053
  25. an interaction between Ste2p and Ste3p has roles in yeast cellular mating PMID: 17369365
  26. presence of an alpha-helix in the segment encompassing residues 10-30, which is perturbed around the internal Pro-24 residue PMID: 17449670
  27. set the stage for the determination of the 3D structure of these large domains of a G protein-coupled receptor in micelles using high-resolution NMR PMID: 18260136
  28. alpha-Factor induced stabilization of the dimeric form and higher order oligomeric forms of the Ste2p receptor. PMID: 18996443
  29. Study is the first to report DOPA cross-linking of a peptide hormone to a GPCR and the first to identify a residue-to-residue cross-link between Ste2p and alpha-factor, thereby defining a specific contact point between the bound ligand and its receptor. PMID: 19152328
  30. high-resolution NMR study on an 80-residue fragment of Ste2p; data support stable fold for the TM parts of TM1-TM2; NMR structure is consistent with biochemical experiments that identified the ligand-binding site within this region of the receptor PMID: 19383463
  31. Results support the conclusion that G protein-coupled receptors, including Ste2, form oligomers and not just dimers, since TM1 and TM4 are too far apart in the class A GPCRs to form contacts in the same dimer moiety. PMID: 19588927
  32. The effect of ligand (alpha-factor) on dimer formation of STE2 suggests that dimers are formed in the resting state and the activated state of the receptor by different transmembrane interactions. PMID: 19839649

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 4 family
Database Links

KEGG: sce:YFL026W

STRING: 4932.YFL026W

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1