Recombinant Saccharomyces cerevisiae Protein ARV1(ARV1)

Code CSB-CF002161SVG
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names ARV1
Uniprot No. Q06541
Alternative Names ARV1; YLR242C; Protein ARV1
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region 1-321
Target Protein Sequence MICITCMRPVDSLYTVYSNDHIQLTDCPYCQETVDKYVEIDNVLLFIDLLLLKAGAYRHL VFNALELHLSKYPKRKALNDCQCLRDYTQALLFNVKNWFCKYDRLNRLWLLLLSFEIYLT WVTEESKYIYYLNRNNNDGKLIMLSKKLPESFKWDSAIMRNTITSKVFTWSPPIQYLYFA SYCILDVSLFHTFTQYFILKKLHWKHYSVSSKDVISYTILLSYGAKIFPILMLIWPYDTL ISMSIIKWVANLYIIESLKIVTNLSYWNIIKIFISVSLLRYFMVKPILIVFVAKFNFSVI KNLIHQEFILLLQKSGTYLLL
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediator of sterol homeostasis involved in sterol uptake, trafficking and distribution into membranes. Regulates also the sphingolipid metabolism. Required for growth during anaerobiosis and sterol uptake.
Gene References into Functions
  1. The most liposensitive yeast strain arose due to deletion of the "ARE2 required for viability" (ARV1) gene, encoding an evolutionarily conserved, potential lipid transporter that localizes to the endoplasmic reticulum membrane. PMID: 24273168
  2. Arv1 deficiency affects structure and homeostasis of plasma and ER membranes, and does not affect sterol transport between ER and plasma membrane. PMID: 23668914
  3. In the presence of drug, S. cerevisiae cells lacking Arv1 are unable to induce ERG gene expression, have an altered pleiotrophic drug response, and are defective in multi-drug resistance efflux pump expression PMID: 22142782
  4. Yeast Arv1p is an important protein required for the delivery of an early gycosylphosphatidylinositol (GPI)intermediate, GlcN-acylPI, to the first mannosyltransferase of GPI synthesis in the endoplasmic reticulum lumen. PMID: 18287539
Subcellular Location Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Protein Families ARV1 family
Database Links

KEGG: sce:YLR242C

STRING: 4932.YLR242C

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1