Recombinant Saccharomyces cerevisiae Protein CCC1(CCC1)

Code CSB-CF341728SVG
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names CCC1
Uniprot No. P47818
Alternative Names CCC1; YLR220W; L8083.6; Protein CCC1; Cross-complementer of CSG1 protein 1
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region 1-322
Target Protein Sequence MSIVALKNAVVTLIQKAKGSGGTSELGGSESTPLLRGSNSNSSRHDNLSSSSSDIIYGRN SAQDLENSPMSVGKDNRNGDNGSDNEKANLGFFQSVDPRVISDLIIGLSDGLTVPFALTA GLSSLGDAKLVITGGFAELISGAISMGLGGYLGAKSESDYYHAEVKKEKRKFYDNSNLIN REIEDILLEINPNFSDETIVSFIKDLQRTPELMVDFIIRYGRGLDEPAENRELISAVTIG GGYLLGGLVPLVPYFFVSDVGTGLIYSIIVMVVTLFWFGYVKTKLSMGSGSSTSKKVTEG VEMVVVGGVAAGAAWFFVKLLG
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has a role in both calcium and manganese homeostasis. Involved in the transfer of iron and Mn(2+) from the cytosol to the vacuole for storage of these metals.
Gene References into Functions
  1. The identification of multiple independent transcriptional pathways that regulate the levels of Ccc1 under high iron conditions accentuates the importance of protecting cells from the toxic effects of high iron PMID: 29043483
  2. Data suggest that SNF1 deletion acts synergistically with YAP5 deletion to regulate transcription of vacuolar iron importer CCC1 and to regulate iron resistance; SNF1 deletion with MSN2/MSN4 deletion results in additive effects on CCC1 transcription. (SNF1 = sucrose non-fermenting kinase 1; YAP5 = transcription factor YAP5; CCC1 = Ca(II)-sensitive cross-complementer 1; MSN = stress-responsive transcriptional activator) PMID: 28760824
Subcellular Location Golgi apparatus membrane. Vacuole membrane; Multi-pass membrane protein.
Protein Families CCC1 family
Database Links

KEGG: sce:YLR220W

STRING: 4932.YLR220W

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1