Recombinant Saccharomyces cerevisiae pH-response regulator protein palH/RIM21(RIM21)

Code CSB-CF344146SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P48565
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MNLWRHSPEELAAYNSCHPMKLGSGVLIQLPLYDNSAVYAEDITFRSFCCERVPVYVSTV LRNSSPYRYLDEVINDWQKFIQVSDYVGGSAEYAIYAVILSITSNFVITVFLTVICCINI SGRAYKRILQLLRIASLLASLNLTIFITKVLRRLEKEHNVYGVVRAHSIMHIFSDDMTFV VLDFLATLMFQFCQVGIVIRLFQRAQEKRIIFFIGVILTITANILWVIPPFANHTTKHRN DWQILRPFVYLFRIAIATSYASIVIYHIWQKKKLWFKFNQMGLLTLLTILVVLLLPGFFL ADVSNLWISELGEVFNTTCYVTSTVITWEWLDRLNVLERKEEAQSILGRPIFEEEQQDYR FAKYALRVQNALTRRESQDASTDRHDTSSNSEVCDLQTISRYDPEDQISVGRSIDRMHFN DRGTYKDVALKKLGYARDKILYFTDQIVQKSVGHNNSSSSKNEKTKQRKAMVRKRLGLDK PGIYIYSTKDVVFNSDEDDDENAEDEDDDEYEVGSEGNNNSSATFTSDHIGHI
Source in vitro E.coli expression system
Gene Names RIM21
Protein Names Recommended name: pH-response regulator protein palH/RIM21 Alternative name(s): Regulator of IME2 protein 21
Expression Region 1-533
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH (By similarity). Required for growth at alkaline pH.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families PalH/RIM21 family
Database Links

KEGG: sce:YNL294C

STRING: 4932.YNL294C

Related Products

RIM21 Antibodies

RIM21 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

RIM21 Proteins

RIM21 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.