Recombinant Saccharomyces cerevisiae pH-response regulator protein palH/RIM21(RIM21)

Code CSB-CF344146SVG
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names RIM21
Uniprot No. P48565
Alternative Names RIM21; PAL2; YNL294C; N0466; pH-response regulator protein palH/RIM21; Regulator of IME2 protein 21
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region 1-533
Target Protein Sequence MNLWRHSPEELAAYNSCHPMKLGSGVLIQLPLYDNSAVYAEDITFRSFCCERVPVYVSTV LRNSSPYRYLDEVINDWQKFIQVSDYVGGSAEYAIYAVILSITSNFVITVFLTVICCINI SGRAYKRILQLLRIASLLASLNLTIFITKVLRRLEKEHNVYGVVRAHSIMHIFSDDMTFV VLDFLATLMFQFCQVGIVIRLFQRAQEKRIIFFIGVILTITANILWVIPPFANHTTKHRN DWQILRPFVYLFRIAIATSYASIVIYHIWQKKKLWFKFNQMGLLTLLTILVVLLLPGFFL ADVSNLWISELGEVFNTTCYVTSTVITWEWLDRLNVLERKEEAQSILGRPIFEEEQQDYR FAKYALRVQNALTRRESQDASTDRHDTSSNSEVCDLQTISRYDPEDQISVGRSIDRMHFN DRGTYKDVALKKLGYARDKILYFTDQIVQKSVGHNNSSSSKNEKTKQRKAMVRKRLGLDK PGIYIYSTKDVVFNSDEDDDENAEDEDDDEYEVGSEGNNNSSATFTSDHIGHI
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH. Required for growth at alkaline pH.
Gene References into Functions
  1. The C-terminal cytosolic domain of Rim21 was associated with the plasma membrane under normal conditions but dissociated upon alterations in lipid asymmetry. PMID: 26527678
  2. plasma membrane depolarization seems to be one of the key signals for the pH sensor molecule Rim21 PMID: 23019326
Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families PalH/RIM21 family
Database Links

KEGG: sce:YNL294C

STRING: 4932.YNL294C

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1