Recombinant Salmo salar G-protein coupled receptor 183(gpr183)

Code CSB-CF009792SWI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B5X337
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Salmo salar (Atlantic salmon)
Sequence MQVMRTFNQPPTSSHPTPTLNDSDTCITLYNHRGYARVLMPLFYCIVFFVGLLGNALAFH IIRPNVKKINSTTLYSANLVISDILFTLSLPLRIIYYALGFHWPLGETLCKIVGLIFYIN TYAGVNFMTCLSVDRFIAVVLPLRFARFRKVSNVRYICVGVWLLVLMQTLPLLSMPMTNE EPDGFITCMEYPNFEPVPNISYILIGAVFLGYGVPVVTILVCYSILCCKLRLAAKANQLT DKSGRSQKAIGVICCVSLVFVVCFSPYHIDLLQYMIRKLIYTPDCAELTAFQISLHFTVC LMNLNSCLDPFIYFFACKGYKTKVLKILKRQVSVSFSSAARTLPEGLSRDISDGNKIHLN STRHKE
Source in vitro E.coli expression system
Gene Names gpr183
Protein Names Recommended name: G-protein coupled receptor 183
Expression Region 1-366
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function G-protein coupled receptor expressed in lymphocytes that acts as a chemotactic receptor for B-cells, T-cells, splenic dendritic cells, monocytes/macrophages and astrocytes (By similarity). Receptor for oxysterol 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC) and other related oxysterols (By similarity). Mediates cell positioning and movement of a number of cells by binding the 7-alpha,25-OHC ligand that forms a chemotactic gradient (By similarity). Binding of 7-alpha,25-OHC mediates the correct localization of B-cells during humoral immune responses (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: sasa:100195196

UniGene: Ssa.3441

Related Products

gpr183 Proteins

gpr183 Proteins for Salmo salar (Atlantic salmon)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.