Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf18(wtf18)

Code CSB-CF524867SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O74495
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MKNNYTSLKSPLDEEDELKTDHEIDLEKGLLPEYNSEEEGTLPLYSDISKLANPVPEDSS TGPTEIANPNVERRQEFKDSHPNIYFLLRLLISVLAVSVVFFTAWVCVNPLEKSIFGKVA FSVTIGITCPILFIATFCFFETWTQAVAQCIKVTVIFLAQCVKVTAVFLAKCVKVIAVGL YNSKKDLVVTIWLAWVVICFILFGCVKDGRLNLNKALICSTCSISAALFFILLLVCIPIW TLKHMLFGLFQVLGVQSCVVIVTKGLMYLFDKHIDATGYEIEASSLFVIGNFLFFYEMEC PGALKRMPKFIRNGIASFLEGIGNAFGGIGNAIGRIGNAFRGANDNNNNIPLEETEAESE V
Source in vitro E.coli expression system
Gene Names wtf18
Protein Names Recommended name: Uncharacterized protein wtf18
Expression Region 1-361
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families WTF family
Database Links

KEGG: spo:SPCC285.07c

STRING: 4896.SPCC285.07c.1

Related Products

wtf18 Antibodies

wtf18 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

wtf18 Proteins

wtf18 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.