Recombinant Sheep Oxytocin receptor(OXTR)

Code CSB-CF017316SH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q28756
Storage Buffer Tris-based buffer,50% glycerol
Species Ovis aries (Sheep)
Sequence MEGAFAANWSAEAVNGSAAPPGTEGNRTAGPPQRNEALARVEVAVLSLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLAVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTEAAAA EASAGAEGAAADCAGRAALARVSNVKLISKAKIRTVKMTFIVVLAFIVCWTPFFFKQMWS VWDADAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFQDLVQRFLCCSFRRLKGSQLG ETSVTKKIHSYTFVLSRHSSSQRSCSQPSTV
Source in vitro E.coli expression system
Gene Names OXTR
Protein Names Recommended name: Oxytocin receptor Short name= OT-R
Expression Region 1-391
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Database Links

UniGene: Oar.823

Pathway Calcium signaling pathway
cAMP signaling pathway

Related Products

OXTR Proteins

OXTR Proteins for Ovis aries (Sheep)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.