Recombinant Xenopus laevis Vesicle-associated membrane protein 2(vamp2)

Code CSB-CF025781XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P47193
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xenopus laevis (African clawed frog)
Sequence SAPAAGPPAAAPGDGAPQGPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDTKLSELDDRADALQAGASQFETSAAKLKRKYWWKNMKMMIIMGVICAIILIIIIVYFST
Source in vitro E.coli expression system
Gene Names vamp2
Protein Names Recommended name: Vesicle-associated membrane protein 2 Short name= VAMP-2 Alternative name(s): SYBII Synaptobrevin-2
Expression Region 2-114
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the targeting and/or fusion of transport vesicles to their target membrane.
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome, Cell membrane
Protein Families Synaptobrevin family
Database Links

KEGG: xla:394287

UniGene: Xl.234

Pathway Secreted Extracellular Vesicles
Synaptic vesicle cycle

Related Products

vamp2 Proteins

vamp2 Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.