Home
Protein
Transmembrane Proteins
Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE (yopE)

Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE (yopE)

^{In Stock}

Code	CSB-CF330087YAQ
Abbreviation	Recombinant Yersinia enterocolitica yopE protein
MSDS	MSDS Datasheet
Size	$878
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

yopE

Uniprot No.

P31492

Research Area

Others

Alternative Names

yopE; yop25; Outer membrane virulence protein YopE

Species

Yersinia enterocolitica

Source

in vitro E.coli expression system

Expression Region

1-219aa

Target Protein Sequence

MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

26.9kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Design a plasmid containing the gene sequence encoding the Yersinia enterocolitica yopE (1-219aa) with the N-terminal 6xHis tag. This plasmid also includes other regulatory elements such as a promoter, ribosome binding site (RBS), and a terminator sequence. Linearize the recombinant plasmid using restriction enzymes. Add substrates, energy, amino acids, nucleotides, cofactors, salts, and an inducer IPTG to the E. coli cell-free extract to induce protein expression. This will trigger the promoter and initiate transcription and translation of the yopE gene. Monitor protein synthesis and harvest the reaction when the desired protein yield is achieved. Apply the harvested reaction mixture to an affinity column to obtain the purified yopE protein. Analyze the purified recombinant Yersinia enterocolitica yopE protein using SDS-PAGE to confirm identity and purity. Its purity is over 90%.