Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE(yopE)

Code CSB-CF330087YAQa2
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P31492
Relevance Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Yersinia enterocolitica
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM
Research Area Others
Source in vitro E.coli expression system
Gene Names yopE
Expression Region 1-219aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 38.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.
Subcellular Location Cell outer membrane
Protein Families YopE family

Related Products

yopE Proteins

yopE Proteins for Yersinia enterocolitica

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.