Recombinant Human Fibroblast growth factor 8(FGF8),partial (Active)

In Stock
Code CSB-AP004041HU
Product Type Growth Factor
Size $137Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P55075
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4
Alias Fibroblast growth factor 8;Androgen-induced growth factor;Heparin-binding growth factor 8;AIGF;HBGF-8;FGF-8B
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 0.5 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence QEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Research Area Cancer
Source E.coli
Gene Names FGF8
Expression Region 23-244aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 27.7 kDa
Protein Description Partial of Isoform 4
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system
Involvement in disease Hypogonadotropic hypogonadism 6 with or without anosmia (HH6)
Subcellular Location Secreted
Protein Families Heparin-binding growth factors family
Database Links

HGNC: 3686

OMIM: 600483

KEGG: hsa:2253

STRING: 9606.ENSP00000321797

UniGene: Hs.57710

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Ras signaling pathway
Rap1 signaling pathway

Related Products

FGF8 Antibodies

FGF8 Antibodies for Homo sapiens (Human)

FGF8 Antibodies for Human

FGF8 Proteins

FGF8 Proteins for Homo sapiens (Human)

FGF8 ELISA Kit

FGF8 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.