Recombinant Human Thrombopoietin(THPO) (Active)

In Stock
Code CSB-AP003971HU
Product Type Growth Factor
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P40225
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Alias Thrombopoietin;C-mpl ligand;Megakaryocyte colony-stimulating factor;Megakaryocyte growth and development factor;Myeloproliferative leukemia virus oncogene ligand;THPO
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is less than 10 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Research Area Cancer
Source Mammalian cell
Gene Names THPO
Expression Region 22-353aa
Tag Info N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Mol. Weight 37.3 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
Involvement in disease Thrombocythemia 1 (THCYT1)
Subcellular Location Secreted
Protein Families EPO/TPO family
Database Links

HGNC: 11795

OMIM: 187950

KEGG: hsa:7066

STRING: 9606.ENSP00000204615

UniGene: Hs.1166

Pathway Jak-STAT signaling pathway
Hematopoietic cell lineage

Related Products

THPO Antibodies

THPO Antibodies for Homo sapiens (Human)

THPO Proteins

THPO Proteins for Homo sapiens (Human)

THPO ELISA Kit

THPO ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.