Recombinant Human Transforming growth factor beta-2 proprotein(TGFB2),partial (Active)

In Stock
Code CSB-AP003961HU
Size US$3564Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T?cells is less than 15 ng/ml.
Target Names TGFB2
Uniprot No. P61812
Research Area Cancer
Alternative Names BSC-1 cell growth inhibitor; BSC1 cell growth inhibitor; Cetermin; G-TSF; Glioblastoma-derived T-cell suppressor factor; GTSF; LAP; Latency-associated peptide; MGC116892; MGF; Milk growth factor; Polyergin; TGF-beta-2; TGF-beta2; TGFB2; TGFB2_HUMAN; Transforming growth factor beta 2
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 303-414aa
Complete Sequence ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Mol. Weight 12.7 kDa
Protein Length Partial
Tag Info Tag-Free
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm Filtered 4 mM HCl
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.
Gene References into Functions
  1. Furthermore, upregulation of miR-328 could further repress the expression of TGF-beta2 and ECM proteins. In conclusion, this study demonstrated that miR-328 could prevent renal fibrogenesis by directly targeting TGF-beta2. Our findings suggested that elevated renal miR-328 levels might be a novel therapeutic strategy for treating renal fibrosis PMID: 30160133
  2. Importantly, high expression levels of HIF-1alpha/TGF-beta2/GLI2 correlated robustly with the patient relapse following chemotherapy, highlighting a potential biomarker and therapeutic target for chemoresistance in colorectal cancer. PMID: 29891662
  3. these data suggest that miR-592 may exert it suppressive role in breast cancer, at least in part, by targeting TGFbeta-2, and that miR-592 may be a novel target for breast cancer treatment PMID: 29039599
  4. MicroRNA-486-5p suppresses TGFB2-induced proliferation, invasion and epithelial-mesenchymal transition of lens epithelial cells by targeting Smad2. PMID: 29229876
  5. Results show that TGF-beta2 is highly expressed in glioma and correlated with poor prognosis in glioma patients. Further findings elucidate a potential mechanism of autophagy-associated glioma invasion that TGF-beta2 could initiate autophagy via Smad and non-Smad pathway to promote glioma cells' invasion. PMID: 29145888
  6. Up-regulation of TGF-beta2 showed a strong association with muscle invasion in bladder cancer. PMID: 28261684
  7. Report early adaptive drug-escape in EGFR-mutant lung tumor cells dependent on TGFbeta2-bioenergetics-mitochondrial priming. PMID: 27852038
  8. The expression of TGFB2 obtained by microarray analysis was consistent with that of RT-PCR. Ion transport could be affected promptly after ANP treatment, and subsequently, the cytolysis of vein endothelial cells may be promoted and endothelial permeability would be enhanced, followed by activated immune responses. PMID: 29279524
  9. 4.7 Mb deletion encompassing TGFB2 is associated with features of Loeys-Dietz syndrome and osteoporosis. PMID: 28544325
  10. results imply that the interaction of matrix AGEs with RAGE plays a role in the TGFbeta2-mediated EMT of lens epithelial cells and suggest that the blockade of RAGE could be a strategy to prevent PCO and other age-associated fibrosis. PMID: 27263094
  11. results support that the regulation of miR-30b by VEGF in HUVEC is important for capillary morphogenesis, as increased miR-30b expression inhibits capillary morphogenesis through enhanced expression of TGFbeta2 PMID: 28977001
  12. Data suggest that TGFB2 (the most abundant growth factor in human milk) binding to Tgfb2r elicits robust/rapid response in small intestinal mucosal cells leading to stimulation of Egr1 transport to nucleus and cell differentiation; more than 15 Wnt signaling pathway genes have Egr1 binding sites/response elements; Egr1 binds to Axin1 promoter and functionally activates gene expression. (Axin1 = axis inhibition protein 1) PMID: 27697743
  13. RUNX1T1 serves as a common angiogenic driver for vaculogenesis and functionality of endothelial lineage cells PMID: 28640846
  14. High TGFbeta2 expression is associated with oral cancer. PMID: 27803052
  15. TGF-beta2 is a new regulatory factor for KCC2 functional activation and membrane trafficking. PMID: 27505893
  16. Our data expand the phenotype of Loeys-Dietz syndrome type 4 : we confirm that TGFb2 mutations are responsible for true Loeys-Dietz (LDS) syndrome with non-specific features of connective tissue disorders and diffuse vascular lesions PMID: 27440102
  17. TGF-beta signaling regulated cell growth of cancer associated fibroblasts. PMID: 27880067
  18. Localized constitutive expression and release of TGF-beta2 by TM cells may promote or exacerbate elevation of IOP in POAG. PMID: 26743044
  19. Advanced glycation endproduct in the lens capsule promote the TGFbeta2-mediated fibrosis of lens epithelial cells. PMID: 26853893
  20. Our study suggests that lnc-ATB promotes tumor progression by interacting with miR-141-3p and that Lnc-ATB may be a valuable prognostic predictor for GC. In conclusion, the positive feedback loop of lnc-ATB/miR-141-3p/TGF-beta2 may be a potential therapeutic target for the treatment of GC. PMID: 28115163
  21. decorin can alter the bioactivity of TGF-beta2 on human myoblast migration PMID: 27644884
  22. findings indicate that lncRNA-ATB governs the autocrine secretion of TGF-beta2 in KFs, at least in part, by downregulating the expression level of ZNF217 via miR-200c, suggesting a signaling axis consisting of lncRNA-ATB/miR-200c/ZNF217/TGF-beta2 PMID: 27090737
  23. association between SNP rs6658835 in TGF-beta2 and conotruncal heart defects PMID: 27564654
  24. miR-422a directly targeted TGFbeta2 and regulated its expression and the activation of downstream molecules, smad2 and smad3 in osteosarcoma cells. PMID: 27779704
  25. miR-378a expression is associated with its methylation status in TGF-beta1-treated cells, and epigenetically-regulated miR-378a inhibits TGF-beta1-induced hepatic stellate cells activation, at least in part, via TGF-beta2. PMID: 27855367
  26. we detected and verified a list of differentially expressed microRNAs in PE placentas by HTS and qRT-PCR, and provided preliminary evidence for the role of miR-193b-3p in the pathogenesis of preeclampsia by targeting TGF-beta2. PMID: 26822621
  27. Likely pathogenic variants included a TGFB2 variant in one patient and a SMAD3 variant in another. These variants have been reported previously in individuals with similar phenotypes. Variants of uncertain significance of particular interest included novel variants in MYLK and MFAP5, which were identified in a third patient PMID: 26854089
  28. Results provide evidence that miR-148a decreases the expression of TGFbeta2 and SMAD2 in gastric cancer cells through binding to their 3'UTRs. PMID: 26983401
  29. TGF-beta2 induces epithelial-mesenchymal transition by activating the PI3K/Akt/mTOR signaling pathway in cultured human lens epithelial cells. PMID: 26647778
  30. Human retinal pigment epithelial cells were cultured in the presence or absence of TGF-beta2, and reverse-transcription quantitative PCR was performed to determine the mRNA expression of IDO and Nrf2. PMID: 26676103
  31. TGF-beta2 induces Grb2 to recruit PI3-K to TGF-RII that activates JNK/AP-1-signaling and augments invasiveness of Theileria-transformed macrophages. PMID: 26511382
  32. In conclusion, each of the DPP-4 inhibitors may have unique drug-specific effects. PMID: 26826382
  33. Active CREB1 promotes a malignant TGFbeta2 autocrine loop in glioblastoma. PMID: 25084773
  34. Comparison of the aqueous humor TGF-beta2 level between patients with open-angle glaucoma (OAG) and controls provides direct evidence for the role of TGF-beta2 in the etiology of OAG. (meta-analysis) PMID: 26019480
  35. there is a borderline significant association between higher mean TGF-beta2 levels in breast milk and more severe pathologic diagnoses PMID: 25604865
  36. These results suggest that miR-200a suppresses RCC development via directly targeting TGFB2, indicating that miR-200a may present a novel target for diagnostic and therapeutic strategies in renal cell carcinoma PMID: 25813153
  37. TGFbeta2 is a key growth promoter of CD44(hi) cells that survived chemotherapy and also is a growth inhibitor of cells that survived hypoxia. PMID: 26340918
  38. MicroRNA-153 inhibits osteosarcoma cells proliferation and invasion by targeting TGF-beta2 PMID: 25793604
  39. High expression of TGFB2 is associated with melanoma. PMID: 25743834
  40. Data suggest that the intrinsic transforming growth factor beta 2-triggered stromal cell-derived factor-1-C-X-C chemokine receptor-4 signaling is crucial for drug resistance in bone marrow (BM)-slow-cycling disseminated tumor cells (DTCs). PMID: 25504440
  41. Here, we show that increased TGF-beta2 signaling through ALK5 plays a role in hypoxia-induced redifferentiation of chondrocytes. PMID: 25621374
  42. TGF-beta2 secretion from retinal pigmented epithelium decreases with polarization and becomes apically oriented PMID: 25496702
  43. glycated collagen in the cardiac interstitium triggers an autocrine TGF-beta2 signaling pathway that stimulates alpha11 integrin expression through Smad2/3 binding elements in the alpha11 integrin promoter PMID: 24962729
  44. these results revealed no correlation between the normalized expression of TGF-beta2, TGF-betaRI, or TGF-betaRII and EDSS scores PMID: 26037400
  45. these data shed light on previously unrecognized roles of Mkx in tendinopathy, tenogenesis, and tendon repair as well as in regulating the TGFbeta pathway. PMID: 25332192
  46. High levels of furin, TNF-alpha and TGF-beta2 may be the reason of proceeding decidualization, placentation, and prevention from abortion, in spite of terminating the fetal life. PMID: 26065233
  47. TGF-beta2 therefore promotes the adhesion and invasiveness of virulent macrophages by modulating COX2, EP4, and PKIG transcription to initiate a prostaglandin E2 (PGE2)-driven autostimulatory loop that augments PKA and EPAC activities. PMID: 25690101
  48. TGF-beta2 induced MYOC expression and secretion in human primary cultured trabecular meshwork cells PMID: 25197353
  49. Data indicate that TGF-beta2 (TGFB2) and TGF beta type III receptor (TGFBR3) are target genes of miR-193b in chondrogenesis. PMID: 25728278
  50. ALDH1 and TGFbeta2 play important roles in the development of breast cancer. PMID: 25120797
  51. A new gene mutation was identified in TGFB2 involved in non-syndromic aortic disease. PMID: 25046559
  52. our results suggest that HOXB7 promotes tumor progression in a cell-autonomous and non-cell-autonomous manner through activation of the TGFbeta signaling pathway PMID: 25542862
  53. Data suggest that Muller cells release TGF-beta2, inhibiting the proliferation of retinal endothelial cells via activation of Smad2/Smad3 and attenuation of ERK signaling PMID: 24838936
  54. Serum TGFB2 was elevated in patients with classic prolapse as compared with the control group and the non-classic mitral valve prolapse group. PMID: 23880103
  55. TGFB2 is a rarely mutated gene in patients with syndromic TAAD, and the clinical features of our TGFB2 mutation-positive individuals fit in the scheme of LDS, rather than MFS-related disorders. PMID: 24193348
  56. TGF- beta 2 is likely to be acting as a critical factor in axial elongation and development of myopia. PMID: 24967344
  57. However, activation of the gp130 cell surface receptor is both necessary and sufficient for downregulation of TGF-beta2 in Kaposi's sarcoma-associated herpesvirus-infected cells. PMID: 25275137
  58. rs900 TGF-beta2 is a marker of differential gender susceptibility in sporadic thoracic aortic aneurysm PMID: 24707114
  59. NFkappaB/TGFbeta2 promotes, and betaglycan impedes, the early stages of granulosa cell tumor metastasis, when tumor cells first invade the peritoneum PMID: 25128652
  60. Data confirm that mutations in TGFB2 gene do not always lead to aggressive vascular phenotypes and that articular and skeletal signs are prevalent. PMID: 25163805
  61. TGFB2 is located in genes previously associated with chronic obstructive pulmonary disease susceptibility. PMID: 25006744
  62. Data indicate that glioma cell migration is mediated by Thrombospondin-1 (THBS-1) and TGF-beta2. PMID: 24223867
  63. Consumption of animal protein and parturition characteristics may affect TGF-beta levels in breast milk, and may explain differences in these levels in breast milk between countries. PMID: 25003733
  64. TGF-beta2, CTGF and gremlin are all involved in epithelial mesenchymal transition and extracellular matrix synthesis via activation of Smad signaling pathway in lens epithelial cells. PMID: 24755068
  65. germline mutation of the TGFbeta2 gene is not a common cause of CTD in humans and that the TGFbeta2 expression level may be less critical in humans than in animals for the pathogenesis of CTD. PMID: 23712828
  66. Inhibition of miR-21 has no effect on thrombospondin (TSP)-1-stimulated expression of TGFbeta2. PMID: 24314882
  67. TGFbeta2 protein and localization of mutations are identified in patients with thoracic aortic aneurysm and/or dissection. PMID: 23102774
  68. HD3alpha directly interacts with HDAC3 and Akt1 and selectively activates transforming growth factor beta2 (TGFbeta2) secretion and cleavage. PMID: 24045946
  69. data permit us to suggest an important role of TbetaRII expression in the maintenance of chondrocyte phenotype, which is altered with age, and bring new insights in our understanding of chondrogenesis process. PMID: 22653295
  70. TGFbeta2 increased NFkappaB reporter activity in control cells, but betaglycan expression suppressed both basal and TGFbeta2-stimulated NFkappaB activity. PMID: 23322721
  71. MMP-2 and -9 are involved in the translocation of MRTF-A in lens epithelial cellsduring TGFbeta-induced epithelial to mesenchymal transition. PMID: 23687438
  72. the microenvironment at the verge between inflammation (IL-1beta) and tissue remodeling (TGFbeta2) can strongly promote the process of EndMT. PMID: 22739237
  73. TGFbetaRIIb expression is a regulatory mechanism for TGFbeta2 signal transduction. PMID: 23099432
  74. TGF-beta decreases baseline and IL-13-stimulated mucin production by primary human bronchial epithelial cells. PMID: 23249391
  75. SDC-2 modulates TGFbeta2 transcriptional regulation via Smad2 signaling to facilitate fibrosarcoma cell adhesion. PMID: 23297089
  76. Mutation or removal of the G-quadruplex sequence from the 5' UTR of the gene diminished the level of expression of this gene at the translational level. PMID: 23387555
  77. TGF-beta(2) reduces proliferation but stimulates migration of cultured corneal endothelial cells via p38MAPK phosphorylation. PMID: 23257207
  78. TGF-beta may contribute to aneurysm formation by promoting the generation of myofibroblasts that mediate damage to the arterial wall through recruitment of pro-inflammatory cells. PMID: 22955109
  79. Transcriptional profiling of human glioblastoma vessels indicates a key role of VEGF-A and TGFbeta2 in vascular abnormalization. PMID: 22786655
  80. No significant associations were identified between FOXC1, TGFbeta2, and BMP4 alleles and haplotypes and primary open-angle glaucoma. PMID: 22736943
  81. TGF beta-2 inhibits the expression of the clock genes Period (Per)1, Per2, and Rev-erb-alpha, and of the clock-controlled genes D-site albumin promoter binding protein (Dbp) and thyrotroph embryonic factor (Tef ) PMID: 22823397
  82. report heterozygous mutations or deletions in the gene encoding the TGF-beta2 ligand for a phenotype within the Loeys-Dietz syndrome spectrum PMID: 22772368
  83. haploinsufficiency for TGFB2 predisposes to thoracic aortic disease, suggesting that the initial pathway driving disease is decreased cellular TGF-beta2 levels leading to a secondary increase in TGF-beta2 production in the diseased aorta PMID: 22772371
  84. TGF-beta2 is abundant in seminal plasma as a key agent in seminal plasma that signals induction of proinflammatory cytokine synthesis in cervical cells. PMID: 22706080
  85. RFX1 reduces cell proliferation through inhibiting the TGFbeta2-ERK signaling pathway. RFX1 blocks TGFbeta2 expression through its direct action on TGFbeta2 transcription. PMID: 22582395
  86. identified transforming growth factor-beta2 secreted by normal kidney and ADPKD cells as an inhibitor of cystogenesis in 3D culture system using ADPKD cells from kidneys PMID: 22504005
  87. The genotypic and allelic frequencies of transforming growth factor beta 2 gene rs6658835 were associated with VSD (P< 0.05), but not with ASD or PDA (P> 0.05). PMID: 22487836
  88. Myxomatous mitral valves are characterized by reduced levels of MT1/2 accompanied by an up-regulation of TGF-beta2. PMID: 22180604
  89. elevated levels of TGF-b2 within the anterior segment contribute to the development of glaucoma; the increased risk for developing glaucoma as one ages may in part be related to the rise of this cytokine PMID: 21034224
  90. quantitative increase in promoter methylation levels of TGFbeta2 is associated with prostate cancer progression PMID: 21207416
  91. A total of 853 proteins were quantified. TGFbeta treatment significantly altered the abundance of 47 proteins, 40 of which have not previously been associated with TGFbeta signaling in the eye. PMID: 21917933
  92. Transforming growth factor-beta2 increases extracellular matrix proteins in optic nerve head cells via activation of the Smad signaling pathway. PMID: 21738403
  93. Data suggest that glioma stem cells are likely to be the major tumor source of immunosuppressive cytokines such as TGF-beta2 and IL-10 and thereby play a crucial role in determining glioma malignancy. PMID: 21088899
  94. BMP-2 and TGFbeta2 shared pathways regulate endocardial cell transformation PMID: 21212630
  95. The present study reveals that TGFbeta2 and NGF are associated with idiopathic epiretinal membranes, suggesting a novel compensatory mechanism so far never proposed. PMID: 21693611
  96. The present paper showed that TGF-beta2 stimulates endothelial-mesenchymal transition through multiple signalling pathways. PMID: 21585337
  97. Gremlin employs canonical TGFbeta2/Smad signaling to induce extracellular matrix protein genes and proteins in cultured human trabecular meshwork cells. PMID: 21642622
  98. Carbachol can promote and atropine can inhibit the expression and secretion of TGF-beta2 in human retinal pigment epithelium cells. PMID: 20543478
  99. differential expression pattern of TGFbeta2 in the lens and retina is correlated with the cell type and differentiation state. PMID: 21446058
  100. Study revealed a correlation between the localization of transforming growth factor-beta2 and the development of intraocular hyaloid vascular network, its regression, formation of the vitreous body, and development of definite retinal vessels. PMID: 21161068

Show More

Hide All

Involvement in disease Loeys-Dietz syndrome 4 (LDS4)
Subcellular Location Secreted
Protein Families TGF-beta family
Database Links

HGNC: 11768

OMIM: 190220

KEGG: hsa:7042

UniGene: Hs.133379

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1