Recombinant Human Transforming growth factor beta-2 proprotein (TGFB2), partial (Active)

In Stock
Code CSB-AP003961HU
Abbreviation Recombinant Human TGFB2 protein, partial (Active)
MSDS
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 cells is 30-180pg/ml.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
BSC-1 cell growth inhibitor; BSC1 cell growth inhibitor; Cetermin; G-TSF; Glioblastoma-derived T-cell suppressor factor; GTSF; LAP; Latency-associated peptide; MGC116892; MGF; Milk growth factor; Polyergin; TGF-beta-2; TGF-beta2; TGFB2; TGFB2_HUMAN; Transforming growth factor beta 2
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
303-414aa
Complete Sequence
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Mol. Weight
12.7 kDa
Protein Length
Partial
Tag Info
Tag-Free
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm Filtered 4 mM HCl
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

TGF-β2 plays a central role in immunosuppression and tumor microenvironment remodeling, making it a critical tool for dissecting glioblastoma biology and broader cancer signaling. This tag-free recombinant human TGFB2 encompasses the mature signaling domain (aa 303–414) and demonstrates potent bioactivity, with an ED50 of 30–180 pg/mL in inhibiting IL-4-dependent TF-1 cell proliferation — a level of receptor-binding potency that supports use in cell proliferation assays, stem cell or neuronal differentiation studies, and in vivo tumor biology models. Mammalian cell expression preserves native-like glycosylation and disulfide bonding essential for proper TGF-β2 folding and receptor engagement, providing a suitable basis for receptor-ligand binding experiments such as SPR and competition ELISA, as well as antibody characterization workflows. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the quality criteria typical for cell-based bioassays and sensitive in vivo studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transforming growth factor beta-2 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-2 (TGF-beta-2) chains, which constitute the regulatory and active subunit of TGF-beta-2, respectively.; Required to maintain the Transforming growth factor beta-2 (TGF-beta-2) chain in a latent state during storage in extracellular matrix. Associates non-covalently with TGF-beta-2 and regulates its activation via interaction with 'milieu molecules', such as LTBP1 and LRRC32/GARP, that control activation of TGF-beta-2.; Transforming growth factor beta-2: Multifunctional protein that regulates various processes such as angiogenesis and heart development. Activation into mature form follows different steps: following cleavage of the proprotein in the Golgi apparatus, Latency-associated peptide (LAP) and Transforming growth factor beta-2 (TGF-beta-2) chains remain non-covalently linked rendering TGF-beta-2 inactive during storage in extracellular matrix. At the same time, LAP chain interacts with 'milieu molecules', such as LTBP1 and LRRC32/GARP, that control activation of TGF-beta-2 and maintain it in a latent state during storage in extracellular milieus. Once activated following release of LAP, TGF-beta-2 acts by binding to TGF-beta receptors (TGFBR1 and TGFBR2), which transduce signal.
Gene References into Functions
  1. Furthermore, upregulation of miR-328 could further repress the expression of TGF-beta2 and ECM proteins. In conclusion, this study demonstrated that miR-328 could prevent renal fibrogenesis by directly targeting TGF-beta2. Our findings suggested that elevated renal miR-328 levels might be a novel therapeutic strategy for treating renal fibrosis PMID: 30160133
  2. Importantly, high expression levels of HIF-1alpha/TGF-beta2/GLI2 correlated robustly with the patient relapse following chemotherapy, highlighting a potential biomarker and therapeutic target for chemoresistance in colorectal cancer. PMID: 29891662
  3. these data suggest that miR-592 may exert it suppressive role in breast cancer, at least in part, by targeting TGFbeta-2, and that miR-592 may be a novel target for breast cancer treatment PMID: 29039599
  4. MicroRNA-486-5p suppresses TGFB2-induced proliferation, invasion and epithelial-mesenchymal transition of lens epithelial cells by targeting Smad2. PMID: 29229876
  5. Results show that TGF-beta2 is highly expressed in glioma and correlated with poor prognosis in glioma patients. Further findings elucidate a potential mechanism of autophagy-associated glioma invasion that TGF-beta2 could initiate autophagy via Smad and non-Smad pathway to promote glioma cells' invasion. PMID: 29145888
  6. Up-regulation of TGF-beta2 showed a strong association with muscle invasion in bladder cancer. PMID: 28261684
  7. Report early adaptive drug-escape in EGFR-mutant lung tumor cells dependent on TGFbeta2-bioenergetics-mitochondrial priming. PMID: 27852038
  8. The expression of TGFB2 obtained by microarray analysis was consistent with that of RT-PCR. Ion transport could be affected promptly after ANP treatment, and subsequently, the cytolysis of vein endothelial cells may be promoted and endothelial permeability would be enhanced, followed by activated immune responses. PMID: 29279524
  9. 4.7 Mb deletion encompassing TGFB2 is associated with features of Loeys-Dietz syndrome and osteoporosis. PMID: 28544325
  10. results imply that the interaction of matrix AGEs with RAGE plays a role in the TGFbeta2-mediated EMT of lens epithelial cells and suggest that the blockade of RAGE could be a strategy to prevent PCO and other age-associated fibrosis. PMID: 27263094
  11. results support that the regulation of miR-30b by VEGF in HUVEC is important for capillary morphogenesis, as increased miR-30b expression inhibits capillary morphogenesis through enhanced expression of TGFbeta2 PMID: 28977001
  12. Data suggest that TGFB2 (the most abundant growth factor in human milk) binding to Tgfb2r elicits robust/rapid response in small intestinal mucosal cells leading to stimulation of Egr1 transport to nucleus and cell differentiation; more than 15 Wnt signaling pathway genes have Egr1 binding sites/response elements; Egr1 binds to Axin1 promoter and functionally activates gene expression. (Axin1 = axis inhibition protein 1) PMID: 27697743
  13. RUNX1T1 serves as a common angiogenic driver for vaculogenesis and functionality of endothelial lineage cells PMID: 28640846
  14. High TGFbeta2 expression is associated with oral cancer. PMID: 27803052
  15. TGF-beta2 is a new regulatory factor for KCC2 functional activation and membrane trafficking. PMID: 27505893
  16. Our data expand the phenotype of Loeys-Dietz syndrome type 4 : we confirm that TGFb2 mutations are responsible for true Loeys-Dietz (LDS) syndrome with non-specific features of connective tissue disorders and diffuse vascular lesions PMID: 27440102
  17. TGF-beta signaling regulated cell growth of cancer associated fibroblasts. PMID: 27880067
  18. Localized constitutive expression and release of TGF-beta2 by TM cells may promote or exacerbate elevation of IOP in POAG. PMID: 26743044
  19. Advanced glycation endproduct in the lens capsule promote the TGFbeta2-mediated fibrosis of lens epithelial cells. PMID: 26853893
  20. Our study suggests that lnc-ATB promotes tumor progression by interacting with miR-141-3p and that Lnc-ATB may be a valuable prognostic predictor for GC. In conclusion, the positive feedback loop of lnc-ATB/miR-141-3p/TGF-beta2 may be a potential therapeutic target for the treatment of GC. PMID: 28115163
  21. decorin can alter the bioactivity of TGF-beta2 on human myoblast migration PMID: 27644884
  22. findings indicate that lncRNA-ATB governs the autocrine secretion of TGF-beta2 in KFs, at least in part, by downregulating the expression level of ZNF217 via miR-200c, suggesting a signaling axis consisting of lncRNA-ATB/miR-200c/ZNF217/TGF-beta2 PMID: 27090737
  23. association between SNP rs6658835 in TGF-beta2 and conotruncal heart defects PMID: 27564654
  24. miR-422a directly targeted TGFbeta2 and regulated its expression and the activation of downstream molecules, smad2 and smad3 in osteosarcoma cells. PMID: 27779704
  25. miR-378a expression is associated with its methylation status in TGF-beta1-treated cells, and epigenetically-regulated miR-378a inhibits TGF-beta1-induced hepatic stellate cells activation, at least in part, via TGF-beta2. PMID: 27855367
  26. we detected and verified a list of differentially expressed microRNAs in PE placentas by HTS and qRT-PCR, and provided preliminary evidence for the role of miR-193b-3p in the pathogenesis of preeclampsia by targeting TGF-beta2. PMID: 26822621
  27. Likely pathogenic variants included a TGFB2 variant in one patient and a SMAD3 variant in another. These variants have been reported previously in individuals with similar phenotypes. Variants of uncertain significance of particular interest included novel variants in MYLK and MFAP5, which were identified in a third patient PMID: 26854089
  28. Results provide evidence that miR-148a decreases the expression of TGFbeta2 and SMAD2 in gastric cancer cells through binding to their 3'UTRs. PMID: 26983401
  29. TGF-beta2 induces epithelial-mesenchymal transition by activating the PI3K/Akt/mTOR signaling pathway in cultured human lens epithelial cells. PMID: 26647778
  30. Human retinal pigment epithelial cells were cultured in the presence or absence of TGF-beta2, and reverse-transcription quantitative PCR was performed to determine the mRNA expression of IDO and Nrf2. PMID: 26676103
  31. TGF-beta2 induces Grb2 to recruit PI3-K to TGF-RII that activates JNK/AP-1-signaling and augments invasiveness of Theileria-transformed macrophages. PMID: 26511382
  32. In conclusion, each of the DPP-4 inhibitors may have unique drug-specific effects. PMID: 26826382
  33. Active CREB1 promotes a malignant TGFbeta2 autocrine loop in glioblastoma. PMID: 25084773
  34. Comparison of the aqueous humor TGF-beta2 level between patients with open-angle glaucoma (OAG) and controls provides direct evidence for the role of TGF-beta2 in the etiology of OAG. (meta-analysis) PMID: 26019480
  35. there is a borderline significant association between higher mean TGF-beta2 levels in breast milk and more severe pathologic diagnoses PMID: 25604865
  36. These results suggest that miR-200a suppresses RCC development via directly targeting TGFB2, indicating that miR-200a may present a novel target for diagnostic and therapeutic strategies in renal cell carcinoma PMID: 25813153
  37. TGFbeta2 is a key growth promoter of CD44(hi) cells that survived chemotherapy and also is a growth inhibitor of cells that survived hypoxia. PMID: 26340918
  38. MicroRNA-153 inhibits osteosarcoma cells proliferation and invasion by targeting TGF-beta2 PMID: 25793604
  39. High expression of TGFB2 is associated with melanoma. PMID: 25743834
  40. Data suggest that the intrinsic transforming growth factor beta 2-triggered stromal cell-derived factor-1-C-X-C chemokine receptor-4 signaling is crucial for drug resistance in bone marrow (BM)-slow-cycling disseminated tumor cells (DTCs). PMID: 25504440
  41. Here, we show that increased TGF-beta2 signaling through ALK5 plays a role in hypoxia-induced redifferentiation of chondrocytes. PMID: 25621374
  42. TGF-beta2 secretion from retinal pigmented epithelium decreases with polarization and becomes apically oriented PMID: 25496702
  43. glycated collagen in the cardiac interstitium triggers an autocrine TGF-beta2 signaling pathway that stimulates alpha11 integrin expression through Smad2/3 binding elements in the alpha11 integrin promoter PMID: 24962729
  44. these results revealed no correlation between the normalized expression of TGF-beta2, TGF-betaRI, or TGF-betaRII and EDSS scores PMID: 26037400
  45. these data shed light on previously unrecognized roles of Mkx in tendinopathy, tenogenesis, and tendon repair as well as in regulating the TGFbeta pathway. PMID: 25332192
  46. High levels of furin, TNF-alpha and TGF-beta2 may be the reason of proceeding decidualization, placentation, and prevention from abortion, in spite of terminating the fetal life. PMID: 26065233
  47. TGF-beta2 therefore promotes the adhesion and invasiveness of virulent macrophages by modulating COX2, EP4, and PKIG transcription to initiate a prostaglandin E2 (PGE2)-driven autostimulatory loop that augments PKA and EPAC activities. PMID: 25690101
  48. TGF-beta2 induced MYOC expression and secretion in human primary cultured trabecular meshwork cells PMID: 25197353
  49. Data indicate that TGF-beta2 (TGFB2) and TGF beta type III receptor (TGFBR3) are target genes of miR-193b in chondrogenesis. PMID: 25728278
  50. ALDH1 and TGFbeta2 play important roles in the development of breast cancer. PMID: 25120797

Show More

Hide All

Involvement in disease
Loeys-Dietz syndrome 4 (LDS4)
Subcellular Location
[Latency-associated peptide]: Secreted, extracellular space, extracellular matrix.; [Transforming growth factor beta-2]: Secreted.
Protein Families
TGF-beta family
Database Links

HGNC: 11768

OMIM: 190220

KEGG: hsa:7042

UniGene: Hs.133379

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*