Recombinant Human Transforming growth factor beta-2(TGFB2)


In Stock
Code CSB-AP003961HU
Product Type Growth Factor
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P61812
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 4 mM HCl
Alias Transforming growth factor beta-2;TGFB2;Polyergin;G-TSF;Glioblastoma-derived T-cell suppressor factor;Cetermin;BSC-1 cell growth inhibitor;TGF-beta-2
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T?cells is less than 15 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Research Area Cancer
Source Mammalian cell
Gene Names TGFB2
Expression Region 303-414aa
Tag Info Tag-Free
Mol. Weight 12.7 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.
Involvement in disease Loeys-Dietz syndrome 4 (LDS4)
Subcellular Location Secreted
Protein Families TGF-beta family
Database Links

HGNC: 11768

OMIM: 190220

KEGG: hsa:7042

UniGene: Hs.133379

Pathway Hippo signaling pathway
MAPK signaling pathway
TGF-beta signaling pathway
Cell cycle
Cellular senescence
Osteoclast differentiation
AGE-RAGE signaling pathway in diabetic complications
FoxO signaling pathway

Related Products

TGFB2 Antibodies

TGFB2 Antibodies for Human

TGFB2 Antibodies for Homo sapiens (Human)

TGFB2 Proteins

TGFB2 Proteins for Homo sapiens (Human)

TGFB2 ELISA Kit

TGFB2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.