Recombinant Human Transforming growth factor beta-2(TGFB2),partial

Code CSB-EP023448HU1
Product Type Recombinant Protein
Size US$1726
Uniprot No. P61812
Relevance TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP023448HU1 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TGFB2.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP023448HU1 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TGFB2.
Storage Buffer Tris-based buffer,50% glycerol
Alias BSC-1 cell growth inhibitorCetermin;Glioblastoma-derived T-cell suppressor factor ;G-TSFPolyergin
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKC
Source E.coli
Gene Names TGFB2
Expression Region 304-413aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 16.7kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.
Involvement in disease Loeys-Dietz syndrome 4 (LDS4)
Subcellular Location Secreted
Protein Families TGF-beta family
Database Links

HGNC: 11768

OMIM: 190220

KEGG: hsa:7042

UniGene: Hs.133379

Pathway Hippo signaling pathway
MAPK signaling pathway
TGF-beta signaling pathway
Cell cycle
Cellular senescence
Osteoclast differentiation
AGE-RAGE signaling pathway in diabetic complications
FoxO signaling pathway

Related Products

TGFB2 Antibodies

TGFB2 Antibodies for Human

TGFB2 Antibodies for Homo sapiens (Human)

TGFB2 Proteins

TGFB2 Proteins for Homo sapiens (Human)

TGFB2 ELISA Kit

TGFB2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.