Recombinant Mouse Fibroblast growth factor 2(Fgf2) (Active)


In Stock
Code CSB-AP004061MO
Product Type Growth Factor
Size $65Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P15655
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 400 mM NaCl, pH 7.0
Alias Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; Fgf2; Fgf-2
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 2 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Research Area Signal Transduction
Source E.coli
Gene Names Fgf2
Expression Region 1-154aa
Tag Info Tag-Free
Mol. Weight 17.15 kDa
Protein Description Full Length
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis.
Subcellular Location Secreted, Nucleus
Protein Families Heparin-binding growth factors family
Database Links

KEGG: mmu:14173

STRING: 10090.ENSMUSP00000037694

UniGene: Mm.473689

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Ras signaling pathway
Signaling pathways regulating pluripotency of stem cells
Rap1 signaling pathway

Related Products

Fgf2 Antibodies

Fgf2 Antibodies for Mouse

Fgf2 Antibodies for Mus musculus (Mouse)

Fgf2 Proteins

Fgf2 Proteins for Mus musculus (Mouse)

Fgf2 ELISA Kit

Fgf2 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.